Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|97_18
Gene name
LocationNODE_97:66631..67565
Strand+
Gene length (bp)934
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus 2.1E-20 16 94
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 9.4E-15 142 202

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016020 membrane Yes
GO:0051641 cellular localization No
GO:0045184 establishment of protein localization No
GO:0051234 establishment of localization No
GO:0071705 nitrogen compound transport No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0015031 protein transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0070727 cellular macromolecule localization No
GO:0008150 biological_process No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 207 229 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1147
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|073970
Agaricus bisporus var bisporus H39 AgabiH39|536300
Agaricus bisporus var bisporus H97 AgabiH97|033530
Agaricus bisporus var bisporus H97 AgabiH97|073970
Rhodonia placenta FPRL280 RhoplFPRL280|97_18 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|97_18
MDTSPTALFDSYEQDFNQIIQSVRGRVDGDAQGEQAEQRKAALRRVEMELDEADEMVSQMEIEIQGIPQSIRPSY
AGRIKTAKAELQRYKKLSKDLHAQYSRADLLGSAARPGMGDALSDDPYGTSTDRTRLLAGTAILEDGTRRLQDSQ
RIALETEEQGTDILRSLRVQREQIENARDTLQRADTSIDRATGTLKKMIRRMYQQRVVTGAIIAVLIILILIILW
AKLWR*
Coding >RhoplFPRL280|97_18
ATGGACACCTCACCGACCGCGCTGTTCGACTCCTACGAGCAGGACTTCAATCAGATCATACAGAGCGTGCGCGGA
AGAGTTGACGGCGATGCGCAGGGCGAACAGGCAGAGCAGCGCAAGGCCGCGTTGCGCAGAGTAGAGATGGAGCTC
GACGAGGCAGATGAGATGGTCTCGCAAATGGAAATAGAGATCCAGGGGATCCCGCAGTCCATCCGCCCTTCGTAC
GCGGGGCGGATCAAGACTGCCAAGGCCGAGCTTCAGCGGTACAAGAAGCTCTCCAAGGACCTGCACGCTCAATAC
TCGCGAGCGGACCTCCTTGGTTCGGCCGCGCGTCCGGGCATGGGCGACGCGCTCTCTGACGACCCGTACGGCACA
TCGACCGACCGTACGCGCCTGCTGGCGGGCACAGCGATTCTAGAGGACGGCACGCGGCGGCTGCAAGATAGTCAG
CGGATTGCTCTCGAGACGGAAGAGCAGGGCACGGACATCCTGCGGAGTTTGCGCGTGCAGCGCGAGCAGATCGAG
AATGCGCGGGATACGCTTCAACGTGCGGATACATCCATTGACCGGGCGACGGGCACGCTGAAGAAGATGATCAGA
CGCATGTACCAACAACGCGTCGTCACTGGCGCAATTATCGCCGTGTTGATCATTCTCATCCTGATCATCCTCTGG
GCGAAGCTCTGGCGGTGA
Transcript >RhoplFPRL280|97_18
ATGGACACCTCACCGACCGCGCTGTTCGACTCCTACGAGCAGGACTTCAATCAGATCATACAGAGCGTGCGCGGA
AGAGTTGACGGCGATGCGCAGGGCGAACAGGCAGAGCAGCGCAAGGCCGCGTTGCGCAGAGTAGAGATGGAGCTC
GACGAGGCAGATGAGATGGTCTCGCAAATGGAAATAGAGATCCAGGGGATCCCGCAGTCCATCCGCCCTTCGTAC
GCGGGGCGGATCAAGACTGCCAAGGCCGAGCTTCAGCGGTACAAGAAGCTCTCCAAGGACCTGCACGCTCAATAC
TCGCGAGCGGACCTCCTTGGTTCGGCCGCGCGTCCGGGCATGGGCGACGCGCTCTCTGACGACCCGTACGGCACA
TCGACCGACCGTACGCGCCTGCTGGCGGGCACAGCGATTCTAGAGGACGGCACGCGGCGGCTGCAAGATAGTCAG
CGGATTGCTCTCGAGACGGAAGAGCAGGGCACGGACATCCTGCGGAGTTTGCGCGTGCAGCGCGAGCAGATCGAG
AATGCGCGGGATACGCTTCAACGTGCGGATACATCCATTGACCGGGCGACGGGCACGCTGAAGAAGATGATCAGA
CGCATGTACCAACAACGCGTCGTCACTGGCGCAATTATCGCCGTGTTGATCATTCTCATCCTGATCATCCTCTGG
GCGAAGCTCTGGCGGTGA
Gene >RhoplFPRL280|97_18
ATGGACACCTCACCGACCGCGCTGTTCGACTCCTACGAGCAGGACTTCAATCAGATCATACAGAGCGTGCGCGGA
AGAGTTGACGGCGATGCGCAGGGCGAACAGGCAGGTGAGCCCGGCTCGCAGCATTCACTTGCGTGGTGACCGAGC
GCAACACAGAGCAGCGCAAGGCCGCGTTGCGCAGAGTAGAGATGGAGCTCGACGAGGCAGATGAGATGGTGCGTT
ATTCGTCTATGATCTCGTGCTTGCGAAGCACTCAACTCACGCTGCGCGGGCGATAGGTCTCGCAAATGGAAATAG
AGATCCAGGGGATCCCGCAGTCCATCCGCCCTTCGTACGCGGGGCGGATCAAGACTGCCAAGGCCGAGCTTCAGC
GGTACAAGAAGCTCTCCAAGGACCTGCACGCTCAATACTCGCGAGCGGACCTCCTTGGTTCGGCCGCGCGTCCGG
GCATGGGCGACGCGCTCTCTGACGACCCGTACGGCACATCGACCGACCGTACGCGCCTGCTGGCGGGCACAGCGA
TTCTAGAGGACGGCACGCGGCGGCTGCAAGATAGTCAGCGGATTGCTCTCGAGACGGAAGAGCAGGGCACGGACA
TCCTGCGGAGTTTGCGCGTGCAGCGCGAGCAGATCGAGAATGCGCGGGATACGGCAAGTCCAACCCTTTCATTAG
AAGCCGTGCTCGTTCGTTGACAGACTTGGCCTGCCTACTTAGCTTCAACGTGCGGATACATCCATTGACCGGGCG
ACGGGCACGCTGAAGAAGATGATCAGACGGTATGTCCCTATCCCGTCTTCCCCAACTGGTGTAACGCTTGTCTCA
TAGTTGGGTATGATGCAGCATGTACCAACAACGCGTCGTCACTGGCGCAATTATCGCCGTGTTGATCATTCTCAT
CCTGATCATCCTCTGGGCGAAGCTCTGGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail