Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|86_1
Gene name
LocationNODE_86:40765..44942
Strand-
Gene length (bp)4177
Transcript length (bp)3183
Coding sequence length (bp)3183
Protein length (aa) 1061

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 7.1E-34 687 926
PF00501 AMP-binding AMP-binding enzyme 3.1E-13 190 340
PF01370 Epimerase NAD dependent epimerase/dehydratase family 7.1E-14 686 899

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|86_1
MLRPPPQTQALSSRTFRVPPLDGSLALPEIYDWHAEHSPEHPVFKFAREDGITKTIYWPEVAHAVRVGAKLITQR
THSEVERDERPIVAILSHSDTIPYFVTAVSVMRAHCVVFPISPRNSPTAVAHLIQKVGVKHILVGQEQAMRDLSS
AALDILESQYPSTPKPNLTPMPLYEDLFFQFVDISLGPIGSTAFPKPIFWTQGRFAEMALIPWFGERDLTGVVWS
LHTMPMYHGMGVLQLYWAPSCGLIVSAFEPKTPAPMPTPDGLFKAAKATDSDVIFCVPSIIEAWAQRPEYVKWLA
SRTGVLFGGGPLNKEAGDYMTSQGVSIFILYGCTEGGIMSPILPDKVGYDWEYFRIPDNVKSHMVPYGNNTYEFV
MVLNHFCTLSVINTQVDGVPAYATSDLFAPHPTKPGYWKIFGRTDDQIMHNTGEKTNPGPLESMLNQDPHVLSSV
MFGRGRFQAGILVDPKSEYRFDPSDEVRLAEFRNKIWPTVERMNAYAPQHSRLFKEMIIVAKPSKPFTYTAKSTA
RRQAVIADYEDEINAVYDKVEESTQSNIPPPAQWDVVSTTDFVRAVVNKVLRQTVNDDDDLFEHGCDSLQATWIR
NSLLRALHDSVETDTRRIADNLVYDNPSVLRLASFISDLACGKDGTETSQAGRVDAMRAMLARYNKHFPLHRADD
HNGDTAGDVLLVTGTTGSLGCHILARLANRHSVSRIFALNRTSRDKTPLRTRQEQALLQRGLSASILEDEKVVLL
EGDLTAARLGLPEETYEKLRQVVTHIVHNAWRVDFNLSLSSFESNIKGLRSLIDLSLTTRQHKPARLIFLSSIGV
YQNVQRNEVQSEALIEPDVAVSSGYTESKWVSEAMLLAAGEETQLNALIVRVGQICGGADGAWNVNEWFPSMVQS
SQKLGVFPIDDGVVSWIQPEVAANAIVDYIKGPATVRVVNLVHPRPCSWNILADAISVSLNIKLVSYQDWLSLLA
TQSQHMAKGKREEHELLRELRALKLLPFFQRLVPGSAASEAMGFPSLATTEAVAASPTLSDPSLRQLTPEDVHRW
IASWKKAGLW*
Coding >RhoplFPRL280|86_1
ATGCTTCGTCCGCCTCCGCAAACTCAAGCCCTCTCGAGCCGTACCTTTCGTGTACCGCCTTTAGACGGATCCCTC
GCCCTGCCAGAGATATATGACTGGCACGCAGAGCATTCGCCGGAGCACCCTGTCTTCAAATTCGCCAGAGAGGAT
GGCATCACTAAAACAATCTACTGGCCAGAGGTGGCGCATGCCGTCCGTGTCGGTGCTAAACTGATCACACAGCGA
ACCCATTCCGAGGTAGAGCGCGATGAAAGACCTATCGTAGCGATATTGTCGCATTCCGACACAATCCCTTACTTT
GTTACTGCGGTTAGTGTGATGCGGGCACATTGCGTCGTTTTCCCGATTTCTCCTCGAAACTCTCCTACCGCGGTG
GCGCATCTGATCCAAAAGGTTGGGGTGAAGCATATCCTTGTAGGGCAGGAGCAAGCCATGCGCGACCTATCGAGT
GCTGCCCTGGATATACTGGAGTCGCAATATCCCTCAACGCCTAAGCCTAACCTGACGCCGATGCCTCTATATGAA
GATTTGTTCTTTCAGTTTGTCGATATCTCACTAGGACCAATAGGCTCCACAGCTTTCCCAAAGCCTATTTTCTGG
ACCCAGGGGCGCTTTGCCGAGATGGCCCTGATCCCGTGGTTTGGGGAACGTGATCTCACGGGTGTCGTCTGGTCT
CTACACACTATGCCCATGTATCATGGAATGGGTGTTCTGCAGCTTTATTGGGCGCCGTCATGTGGACTGATCGTC
AGCGCATTCGAACCGAAGACCCCGGCGCCCATGCCGACACCCGACGGGCTTTTCAAGGCGGCGAAGGCAACTGAC
AGCGATGTCATTTTCTGTGTCCCATCCATCATCGAGGCATGGGCCCAAAGGCCTGAGTATGTTAAATGGTTGGCT
AGCCGCACGGGTGTGCTGTTTGGTGGTGGGCCCCTCAACAAAGAGGCCGGAGACTACATGACATCGCAAGGTGTT
TCTATCTTCATTCTCTATGGATGTACGGAAGGCGGGATCATGAGCCCGATCTTGCCTGATAAGGTCGGCTACGAT
TGGGAATACTTTCGGATTCCCGACAACGTCAAGTCACATATGGTTCCATATGGCAACAATACATACGAATTTGTC
ATGGTGTTGAATCACTTCTGCACACTGAGCGTCATCAATACTCAAGTTGATGGCGTCCCAGCATACGCAACCTCC
GATCTTTTCGCTCCACACCCGACGAAGCCAGGGTATTGGAAGATCTTCGGTCGTACTGATGATCAGATCATGCAC
AATACGGGAGAGAAGACTAATCCGGGCCCATTAGAGAGCATGCTCAATCAAGACCCCCATGTGCTATCCTCAGTG
ATGTTCGGTCGCGGTCGCTTCCAAGCAGGTATTCTGGTGGATCCAAAGTCAGAGTACAGATTCGATCCTTCAGAT
GAAGTGAGGCTGGCTGAATTCAGGAACAAAATTTGGCCAACAGTGGAGAGGATGAACGCATATGCGCCGCAGCAT
TCGAGGTTGTTCAAGGAGATGATCATAGTCGCCAAGCCATCGAAACCATTCACGTACACCGCGAAGAGTACGGCT
CGCAGGCAGGCAGTCATTGCTGACTATGAAGACGAAATCAATGCAGTGTACGACAAGGTGGAAGAGAGCACGCAG
TCAAACATTCCTCCACCAGCACAGTGGGATGTCGTCTCTACCACCGATTTCGTACGCGCCGTCGTGAATAAAGTA
CTCAGGCAAACCGTCAACGACGACGACGATCTCTTCGAGCACGGTTGCGATAGTTTGCAAGCCACATGGATTCGA
AACTCTCTGCTACGAGCACTGCATGATTCTGTTGAGACTGACACACGAAGGATCGCCGACAACCTCGTGTACGAC
AACCCTTCGGTGCTACGCCTCGCCTCGTTCATCTCAGACCTCGCATGTGGTAAGGACGGCACAGAGACATCTCAG
GCTGGACGTGTTGATGCTATGCGCGCCATGCTTGCTCGTTATAACAAACATTTCCCGTTGCACAGAGCAGATGAT
CATAATGGCGATACGGCCGGTGATGTACTTCTGGTCACTGGCACAACTGGAAGCTTGGGATGCCATATCTTGGCT
CGCCTTGCCAATAGGCATAGCGTTTCGCGGATCTTCGCCTTGAATCGAACGTCTAGGGACAAGACACCTCTACGC
ACAAGACAGGAACAAGCACTACTCCAGCGAGGACTGAGTGCAAGTATTCTTGAGGATGAAAAGGTAGTCTTACTC
GAGGGCGACCTCACAGCAGCTAGGCTTGGTCTACCGGAAGAGACTTATGAAAAGCTGCGTCAAGTCGTGACACAC
ATTGTTCATAACGCCTGGAGGGTCGACTTCAATCTCAGTCTCAGCTCATTCGAGAGCAATATCAAGGGCTTGCGC
AGTCTCATCGACTTGTCGCTAACAACACGTCAACATAAACCGGCGCGACTCATCTTCTTGAGCTCAATTGGCGTG
TACCAGAATGTTCAAAGAAACGAAGTGCAGTCTGAAGCACTGATCGAGCCAGACGTCGCAGTAAGCTCAGGCTAC
ACAGAATCCAAATGGGTATCAGAGGCGATGCTGTTGGCCGCTGGCGAGGAGACGCAACTGAATGCTCTGATCGTG
CGTGTTGGCCAGATCTGTGGCGGTGCAGACGGCGCCTGGAACGTGAACGAATGGTTCCCGTCAATGGTTCAAAGC
AGCCAAAAACTGGGCGTATTCCCTATTGATGATGGTGTGGTGAGCTGGATACAGCCGGAAGTAGCCGCGAATGCA
ATCGTCGATTACATTAAGGGTCCCGCCACGGTCAGAGTGGTGAATCTCGTCCATCCACGTCCGTGTTCCTGGAAC
ATTCTAGCGGATGCAATCTCCGTGTCCTTGAACATCAAACTGGTGTCATACCAAGACTGGTTATCGCTGCTGGCC
ACCCAATCTCAGCATATGGCCAAGGGGAAGAGAGAAGAACATGAGCTACTCCGAGAATTGAGGGCTCTGAAATTA
CTGCCCTTTTTCCAGCGTCTTGTGCCAGGGTCAGCTGCCAGTGAGGCAATGGGTTTCCCATCCTTAGCTACGACT
GAAGCAGTCGCCGCATCTCCTACCTTGTCGGACCCATCTCTACGTCAACTGACGCCAGAGGATGTTCACAGATGG
ATTGCGAGTTGGAAGAAGGCAGGATTGTGGTAA
Transcript >RhoplFPRL280|86_1
ATGCTTCGTCCGCCTCCGCAAACTCAAGCCCTCTCGAGCCGTACCTTTCGTGTACCGCCTTTAGACGGATCCCTC
GCCCTGCCAGAGATATATGACTGGCACGCAGAGCATTCGCCGGAGCACCCTGTCTTCAAATTCGCCAGAGAGGAT
GGCATCACTAAAACAATCTACTGGCCAGAGGTGGCGCATGCCGTCCGTGTCGGTGCTAAACTGATCACACAGCGA
ACCCATTCCGAGGTAGAGCGCGATGAAAGACCTATCGTAGCGATATTGTCGCATTCCGACACAATCCCTTACTTT
GTTACTGCGGTTAGTGTGATGCGGGCACATTGCGTCGTTTTCCCGATTTCTCCTCGAAACTCTCCTACCGCGGTG
GCGCATCTGATCCAAAAGGTTGGGGTGAAGCATATCCTTGTAGGGCAGGAGCAAGCCATGCGCGACCTATCGAGT
GCTGCCCTGGATATACTGGAGTCGCAATATCCCTCAACGCCTAAGCCTAACCTGACGCCGATGCCTCTATATGAA
GATTTGTTCTTTCAGTTTGTCGATATCTCACTAGGACCAATAGGCTCCACAGCTTTCCCAAAGCCTATTTTCTGG
ACCCAGGGGCGCTTTGCCGAGATGGCCCTGATCCCGTGGTTTGGGGAACGTGATCTCACGGGTGTCGTCTGGTCT
CTACACACTATGCCCATGTATCATGGAATGGGTGTTCTGCAGCTTTATTGGGCGCCGTCATGTGGACTGATCGTC
AGCGCATTCGAACCGAAGACCCCGGCGCCCATGCCGACACCCGACGGGCTTTTCAAGGCGGCGAAGGCAACTGAC
AGCGATGTCATTTTCTGTGTCCCATCCATCATCGAGGCATGGGCCCAAAGGCCTGAGTATGTTAAATGGTTGGCT
AGCCGCACGGGTGTGCTGTTTGGTGGTGGGCCCCTCAACAAAGAGGCCGGAGACTACATGACATCGCAAGGTGTT
TCTATCTTCATTCTCTATGGATGTACGGAAGGCGGGATCATGAGCCCGATCTTGCCTGATAAGGTCGGCTACGAT
TGGGAATACTTTCGGATTCCCGACAACGTCAAGTCACATATGGTTCCATATGGCAACAATACATACGAATTTGTC
ATGGTGTTGAATCACTTCTGCACACTGAGCGTCATCAATACTCAAGTTGATGGCGTCCCAGCATACGCAACCTCC
GATCTTTTCGCTCCACACCCGACGAAGCCAGGGTATTGGAAGATCTTCGGTCGTACTGATGATCAGATCATGCAC
AATACGGGAGAGAAGACTAATCCGGGCCCATTAGAGAGCATGCTCAATCAAGACCCCCATGTGCTATCCTCAGTG
ATGTTCGGTCGCGGTCGCTTCCAAGCAGGTATTCTGGTGGATCCAAAGTCAGAGTACAGATTCGATCCTTCAGAT
GAAGTGAGGCTGGCTGAATTCAGGAACAAAATTTGGCCAACAGTGGAGAGGATGAACGCATATGCGCCGCAGCAT
TCGAGGTTGTTCAAGGAGATGATCATAGTCGCCAAGCCATCGAAACCATTCACGTACACCGCGAAGAGTACGGCT
CGCAGGCAGGCAGTCATTGCTGACTATGAAGACGAAATCAATGCAGTGTACGACAAGGTGGAAGAGAGCACGCAG
TCAAACATTCCTCCACCAGCACAGTGGGATGTCGTCTCTACCACCGATTTCGTACGCGCCGTCGTGAATAAAGTA
CTCAGGCAAACCGTCAACGACGACGACGATCTCTTCGAGCACGGTTGCGATAGTTTGCAAGCCACATGGATTCGA
AACTCTCTGCTACGAGCACTGCATGATTCTGTTGAGACTGACACACGAAGGATCGCCGACAACCTCGTGTACGAC
AACCCTTCGGTGCTACGCCTCGCCTCGTTCATCTCAGACCTCGCATGTGGTAAGGACGGCACAGAGACATCTCAG
GCTGGACGTGTTGATGCTATGCGCGCCATGCTTGCTCGTTATAACAAACATTTCCCGTTGCACAGAGCAGATGAT
CATAATGGCGATACGGCCGGTGATGTACTTCTGGTCACTGGCACAACTGGAAGCTTGGGATGCCATATCTTGGCT
CGCCTTGCCAATAGGCATAGCGTTTCGCGGATCTTCGCCTTGAATCGAACGTCTAGGGACAAGACACCTCTACGC
ACAAGACAGGAACAAGCACTACTCCAGCGAGGACTGAGTGCAAGTATTCTTGAGGATGAAAAGGTAGTCTTACTC
GAGGGCGACCTCACAGCAGCTAGGCTTGGTCTACCGGAAGAGACTTATGAAAAGCTGCGTCAAGTCGTGACACAC
ATTGTTCATAACGCCTGGAGGGTCGACTTCAATCTCAGTCTCAGCTCATTCGAGAGCAATATCAAGGGCTTGCGC
AGTCTCATCGACTTGTCGCTAACAACACGTCAACATAAACCGGCGCGACTCATCTTCTTGAGCTCAATTGGCGTG
TACCAGAATGTTCAAAGAAACGAAGTGCAGTCTGAAGCACTGATCGAGCCAGACGTCGCAGTAAGCTCAGGCTAC
ACAGAATCCAAATGGGTATCAGAGGCGATGCTGTTGGCCGCTGGCGAGGAGACGCAACTGAATGCTCTGATCGTG
CGTGTTGGCCAGATCTGTGGCGGTGCAGACGGCGCCTGGAACGTGAACGAATGGTTCCCGTCAATGGTTCAAAGC
AGCCAAAAACTGGGCGTATTCCCTATTGATGATGGTGTGGTGAGCTGGATACAGCCGGAAGTAGCCGCGAATGCA
ATCGTCGATTACATTAAGGGTCCCGCCACGGTCAGAGTGGTGAATCTCGTCCATCCACGTCCGTGTTCCTGGAAC
ATTCTAGCGGATGCAATCTCCGTGTCCTTGAACATCAAACTGGTGTCATACCAAGACTGGTTATCGCTGCTGGCC
ACCCAATCTCAGCATATGGCCAAGGGGAAGAGAGAAGAACATGAGCTACTCCGAGAATTGAGGGCTCTGAAATTA
CTGCCCTTTTTCCAGCGTCTTGTGCCAGGGTCAGCTGCCAGTGAGGCAATGGGTTTCCCATCCTTAGCTACGACT
GAAGCAGTCGCCGCATCTCCTACCTTGTCGGACCCATCTCTACGTCAACTGACGCCAGAGGATGTTCACAGATGG
ATTGCGAGTTGGAAGAAGGCAGGATTGTGGTAA
Gene >RhoplFPRL280|86_1
ATGCTTCGTCCGCCTCCGCAAACTCAAGCCCTCTCGAGCCGTACCTTTCGTGTACCGCCTTTAGACGGATCCCTC
GCCCTGCCAGAGATATATGACTGGCACGCAGAGCATTCGCCGGAGCACCCTGTCTTCAAATTCGCCAGAGAGGAT
GGCATCACTAAAACAATCTACTGGCCAGAGGTGGCGCATGCCGTCCGTGTCGGTGCTAAACTGATCACACAGCGA
ACCCATTCCGAGGTAGAGCGCGATGAAAGACCTATCGTAGCGATATTGTCGCATTCCGGTACGTGACTGTTTATA
TGCATGATTTGCCTAAGACCGCTGAACCCCTACGATACGGCAGACACAATCCCTTACTTTGTTACTGCGGTTAGT
GTGATGCGGGCACATTGCGTCGTTTTCCCGATTTCTCCTCGAAACTCTCCTACCGCGGTGGCGCATCTGATCCAA
AAGGTTGGGGTGAAGCATATCCTTGTAGGGCAGGAGCAAGCCATGCGCGACCTATCGAGTGCTGCCCTGGATATA
CTGGAGTCGCAATATCCCTCAACGCCTAAGCCTAACCTGACGCCGATGCCTCTATATGAAGATTTGTTCTTGTCA
CCCACTGATCCGTCCGTTACGCTTGACGACGCTCCATACATCAACCGTGGGTCGGAGACGCTCTGCCTAATTTTA
CATTCGTCAGGTACTCTTCTCTTCTTGAGGAGTCAGTTTGTCGATATCTCACTAGGACCAATAGGCTCCACAGCT
TTCCCAAAGCCTATTTTCTGGACCCAGGGGCGCTTTGCCGAGATGGCCCTGATCCCGTGGTTTGGGGAACGTGAT
CTCACGGGTGTCGTCTGGTCTCTACACACTATGCCCATGTATCATGGAATGGGTGTTCTGCAGCTTTATTGGGCG
GTGAGGATCGTGTTCCCTAATTTACTGTAGATATCACTGAAGTAAGGTGTCTATCACCGAAGCCGTCATGTGGAC
TGATCGTCAGCGCATTCGAACCGAAGACCCCGGCGCCCATGCCGACACCCGACGGGCTTTTCAAGGCGGCGAAGG
CAACTGACAGCGATGTCATTTTCTGTGTCCCATCCATCATCGAGGTATGTGCCGCCGGCGGATTTTTATGGATGC
AGTGTCTGAAGATGCTACAGGCATGGGCCCAAAGGCCTGAGTATGTTAAATGGTTGGCTAGCCGCACGGGTGTGG
TGAGTTTCACGGATCACAACAAGCTGGTAGACGATTGACTGCCGGACATCAGCTGTTTGGTGGTGGGCCCCTCAA
CAAAGAGGCCGGAGACTACATGACATCGCAAGGTGTTTCTATCTTCATTCTCTATGGATGGTCTGTATCCAACGG
TATATGTCCACATTCACCTGTACACTAACAAACTCGCCCGTCATTAGTACGGAAGGCGGGATCATGAGCCCGATC
TTGCCTGGCAGGTACAATTATCGTCCGCGGGATCATTAGCTAACAACTAGTTCAGATAAGGTCGGCTACGATTGG
GAATACTTTCGGATTCCCGACAACGTCAAGTCACATATGGTTCCATATGGCAACAATACATACGAATTTGTCATG
GTGGTATGCTTTTCTCGCGACGTCTTCTGCAAGTGTGATTGTAGACGAAAACATGACAGTTGAATCACTTCTGCA
CACTGAGCGTCATCAATACTCAAGTTGATGGCGTCCCAGCATACGCAACCTCCGATCTTTTCGCTCCACACCCGA
CGAAGCCAGGGTATTGGAAGATCTTCGGTCGTACTGATGATCAGATCATGCACAATACGGGAGAGAAGGTTTATT
GTAGACACTCTTATGACTCTATTTGCAGGTTACTTATATTTTCCTTCTAGACTAATCCGGGCCCATTAGGTCCGC
CGTTCAGTGTTTGCCATCTGCGATATAAGGCTGACGAAGACCACCAGAGAGCATGCTCAATCAAGACCCCCATGT
GCTATCCTCAGTGATGTTCGGTCGCGGTCGCTTCCAAGCAGGTATTCTGGTGGATCCAAAGTCAGAGTACAGATT
CGATCCTTCAGATGAAGTGAGGCTGGCTGAATTCAGGAACAAAATTTGGCGAGTACCTTGCATTTGATTATCAGG
CAGCTAATGATCTCTTTCTGTAGGCCAACAGTGGAGAGGATGAACGCATATGCGCCGCAGCATTCGAGGTTGTTC
AAGGAGGTGCGTTGTGACCACTCTGCTTTTACCGCTACACAATCTAATGTTGACGGGTGCTTTATGTAGATGATC
ATAGTCGCCAAGCCATCGAAACCATTCACGTACACCGCGAAGAGTACGGCTCGCAGGCAGGCAGTCATTGCTGAC
TATGAAGACGAAATCAATGCAGTGTACGACAAGGTGGAAGAGAGCACGCAGTCAAACATTCCTCCACCAGCACAG
TGGGATGTCGTCTCTACCACCGATTTCGTACGCGCCGTCGTGAATAAAGTACTCAGGCAAACCGTCAACGACGAC
GACGATCTCTTCGAGCACGGTTGCGATAGGTCAGTGCAAGCCTTTCCAAACCTATTGATGACTGTAATCACATAA
TATTACAGTTTGCAAGCCACATGGATTCGAAACTCTCTGCTACGAGCACTGCATGATTCTGTTGAGACTGACACA
CGAAGGATCGCCGACAACCTCGTGTACGACAACCCTTCGGTGCTACGCCTCGCCTCGTTCATCTCAGACCTCGCA
TGTGGTAAGGACGGCACAGAGACATCTCAGGCTGGACGTGTTGATGCTATGCGCGCCATGCTTGCTCGTTATAAC
AAACATTTCCCGTTGCACAGAGCAGATGATCATAATGGCGATACGGCCGGTGATGTACTTCTGGTCACTGGCACA
ACTGGAAGCTTGGGATGCCATATCTTGGCTCGCCTTGCCAATAGGCATAGCGTTTCGCGGATCTTCGCCTTGAAT
CGAACGTCTAGGGACAAGACACCTCTACGCACAAGACAGGAACAAGCACTACTCCAGCGAGGACTGAGTGCAAGT
ATTCTTGAGGATGAAAAGGTAGTCTTACTCGAGGGCGACCTCACAGCAGCTAGGCTTGGTCTACCGGAAGAGACT
TATGAAAAGGTATGCTTCTCACTGTGAACAATATTTCCAGCTATTGGCTAACGTTACAACAGCTGCGTCAAGTCG
TGACACACATTGTTCATAACGGTGAGCCGTATTTTCAGTCAACGCCCAAAATACACTAACCTCCTCTTGCAAGCC
TGGAGGGTCGACTTCAATCTCAGTCTCAGCTCATTCGAGAGCAATATCAAGGGCTTGCGCAGTCTCATCGACTTG
TCGCTAACAACACGTCAACATAAACCGGCGCGACTCATCTTCTTGAGCTCAATTGGCGTGTACCAGAGTGAGCTT
TAAATAACACCCTATTGTTGATTCTCGAGCCTCACGCCCTTTTAGATGTTCAAAGAAACGAAGTGCAGTCTGAAG
CACTGATCGAGCCAGACGTCGCAGTAAGCTCAGGCTACACAGAATCCAAATGGGTATCAGAGGCGATGCTGTTGG
CCGCTGGCGAGGAGACGCAACTGAATGCTCTGATCGTGCGTGTTGGCCAGATCTGTGGCGGTGCAGACGGCGCCT
GGAACGTGAACGAATGGTTCCCGTCAATGGTTCAAAGCAGCCAAAAACTGGGCGTATTCCCTATTGATGATGGTG
TGCGTATCTGCGACTATGTGTGATTGTGTGATGAACCTGATATATACGTGTATAGGTGGTGAGCTGGATACAGCC
GGAAGTAGCCGCGAATGCAATCGTCGATTACATTAAGGGTCCCGCCACGGTCAGAGTGGTGAATCTCGTCCATCC
ACGTCCGTGTTCCTGGAACATTCTAGCGGATGCAATCTCCGTGTCCTTGAACATCAAACTGGTGTCATACCAAGA
CTGGTTATCGCTGCTGGCCACCCAATCTCAGCATATGGCCAAGGGGAAGAGAGAAGAACATGAGCTACTCCGAGA
ATTGAGGGCTCTGAAATTACTGCCCTTTTTCCAGCGTCTTGTGCCAGGGTCAGCTGCCAGTGAGGCAATGGGTTT
CCCATCCTTAGCTACGACTGAAGCAGTCGCCGCATCTCCTACCTTGTCGGACCCATCTCTACGTCAACTGACGCC
AGAGGATGTTCACAGATGGATTGCGAGTTGGAAGAAGGCAGGATTGTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail