Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|82_2
Gene name
LocationNODE_82:91427..94287
Strand+
Gene length (bp)2860
Transcript length (bp)2211
Coding sequence length (bp)2211
Protein length (aa) 737

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06588 Muskelin_N Muskelin N-terminus 4.9E-27 1 129
PF13854 Kelch_5 Kelch motif 2.5E-06 186 223
PF13415 Kelch_3 Galactose oxidase, central domain 1.7E-09 201 252
PF13418 Kelch_4 Galactose oxidase, central domain 2.8E-04 189 231
PF01344 Kelch_1 Kelch motif 1.7E-08 200 231

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup2853
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|240900
Agaricus bisporus var bisporus H97 AgabiH97|040350
Rhodonia placenta FPRL280 RhoplFPRL280|82_2 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|82_2
MKTFKVYVGQTEDNMIEAISGALKNDPEKETFSIRHRSSAGIFFPTRYVKIVPISAHDPHYHTSIWYVALSGVSD
EAYMKIVCETHEEARSQYHEASVLRHVLKHLRKRRFLTPFADILSRCGIQLEHPRVTDLYDNIVLQGNWPHSEEL
LQLLVSEGLFDEHQRASPPRAEWTRLHGLDADGDAPCRRGGHAMCMDEENGLIYLFGGWDGQRNLDDFWVYDVRA
DVWRLLSLATGRDLNGPGPRSCHKMAFDRKTGSIYVLGRLLDSDDVDQPAMNSGSVNSPSDSSGVPDIRAASASH
AVDIPRAGSVTRLVWPSTPSEFYRYHTRGLDAGKWDLLTMDTQVCGGPPLIYDHQMVVDSEAQGSWKELRVPGAI
PTVFQRFGHSMLLEPSSHTLIILAGQYREQYAADMHAYHIPTGTLTELFPSVTASGGPEACFTQRAAIDPDLKEI
YVFYGLIRDSPGVTVLDPASSVWVYRYDRPDRPGKWSNTSPANTSGGNSPHGDPISAETPQPRYAHQVVYDRRSK
IAYMHGGTSGVVTNVARTPSEWTGDWPVQALEGLCAVTEVRLDDFWKLRLERPALSDILRRGLFELRRQHFRELC
EDAPPVKALTFLQREVSAVVDHRIQEEAHDFHSLLSHLLAVPPGTSSETDTSTQSSSQDADMPNTEAPREELMDG
PPALVYTMEVDPQETSRGDSPSPARFKQRTELFEKLLIFVNTSAKEPEKDLSELVNTDRED*
Coding >RhoplFPRL280|82_2
ATGAAAACGTTCAAGGTCTACGTTGGGCAAACTGAGGACAACATGATTGAAGCCATCAGTGGTGCCCTCAAGAAC
GATCCCGAAAAGGAGACTTTCTCCATCCGGCACAGAAGCAGTGCTGGCATTTTCTTCCCTACTCGCTATGTTAAG
ATTGTGCCTATCTCTGCCCATGACCCGCACTACCATACCTCAATCTGGTATGTTGCCCTTTCTGGAGTTTCTGAT
GAAGCATATATGAAGATCGTATGTGAGACGCACGAAGAGGCAAGGTCTCAGTATCACGAGGCGTCTGTGCTCCGG
CACGTCCTTAAACACCTACGCAAGCGGCGCTTCCTTACCCCTTTCGCCGACATCCTCTCGCGCTGTGGTATTCAG
CTCGAGCACCCGCGTGTGACAGACCTATACGACAATATCGTGCTCCAGGGAAACTGGCCCCACTCGGAAGAGCTC
CTCCAGCTCCTCGTATCCGAGGGCCTGTTTGATGAGCACCAGCGCGCTAGCCCTCCCCGCGCAGAGTGGACGCGG
CTACATGGCTTGGATGCTGACGGCGACGCACCATGTAGGCGGGGAGGACACGCGATGTGCATGGATGAGGAGAAC
GGGCTGATCTACCTCTTCGGCGGATGGGACGGCCAGCGCAACCTGGACGACTTCTGGGTATACGACGTGCGTGCG
GACGTATGGCGTCTACTGAGCCTTGCAACTGGTCGCGATCTGAATGGCCCAGGCCCGCGCTCGTGCCACAAGATG
GCCTTTGACAGGAAAACGGGATCGATCTACGTCTTGGGACGGCTGCTCGATAGCGATGACGTCGATCAGCCCGCG
ATGAACAGTGGAAGCGTTAATTCTCCTAGTGATAGTTCAGGCGTGCCGGACATACGCGCTGCTTCGGCATCGCAC
GCGGTCGATATCCCACGAGCAGGGAGCGTTACGCGACTCGTATGGCCTTCCACCCCGTCTGAGTTCTATCGATAC
CATACGCGCGGTCTTGATGCGGGAAAGTGGGACTTGTTGACCATGGACACCCAGGTGTGTGGAGGACCGCCATTG
ATATATGATCATCAAATGGTGGTGGATTCCGAGGCGCAAGGGTCTTGGAAAGAGCTCAGAGTTCCTGGGGCAATT
CCCACTGTCTTCCAGCGATTCGGGCACTCAATGTTACTGGAACCATCGTCTCACACACTTATCATACTTGCCGGC
CAGTACAGAGAGCAGTACGCGGCCGACATGCATGCGTATCATATACCGACCGGCACATTGACAGAACTGTTCCCG
AGTGTCACTGCTTCAGGCGGACCGGAAGCATGTTTCACACAGCGCGCAGCTATTGATCCAGACCTCAAAGAGATT
TACGTATTTTATGGACTCATACGCGATAGTCCCGGGGTTACTGTGCTCGACCCTGCGTCATCCGTGTGGGTATAT
CGTTACGACCGGCCAGACCGCCCGGGAAAATGGAGCAACACCTCGCCGGCCAACACCTCTGGTGGGAATTCTCCC
CATGGCGATCCAATCAGCGCGGAGACACCACAGCCGCGCTACGCCCACCAGGTTGTCTACGATCGACGCAGCAAA
ATCGCATATATGCATGGTGGAACCTCTGGAGTCGTGACTAATGTAGCCAGGACCCCAAGTGAATGGACGGGAGAT
TGGCCAGTACAAGCATTGGAGGGCCTATGTGCCGTAACGGAGGTCCGGCTCGACGATTTCTGGAAGCTGCGGTTG
GAGCGGCCGGCCTTATCGGATATTCTACGTCGTGGCCTATTTGAACTACGGCGTCAACACTTCCGCGAGCTATGC
GAGGATGCACCGCCTGTGAAGGCACTCACATTCTTGCAGAGAGAAGTGTCGGCCGTTGTAGATCACAGGATTCAG
GAAGAGGCACACGATTTTCACTCTTTATTGTCGCATCTCCTGGCTGTGCCGCCAGGAACATCGTCAGAAACAGAC
ACCTCGACCCAATCCTCGTCGCAAGACGCAGATATGCCGAATACCGAAGCACCTAGGGAAGAATTGATGGACGGG
CCCCCCGCCTTGGTATATACGATGGAAGTGGATCCACAAGAAACGAGCAGAGGCGATTCACCCTCTCCGGCAAGA
TTCAAACAACGGACGGAGCTGTTCGAGAAATTGCTTATATTCGTGAATACGAGCGCAAAAGAGCCTGAGAAGGAT
TTATCGGAATTAGTCAACACGGATAGGGAGGATTGA
Transcript >RhoplFPRL280|82_2
ATGAAAACGTTCAAGGTCTACGTTGGGCAAACTGAGGACAACATGATTGAAGCCATCAGTGGTGCCCTCAAGAAC
GATCCCGAAAAGGAGACTTTCTCCATCCGGCACAGAAGCAGTGCTGGCATTTTCTTCCCTACTCGCTATGTTAAG
ATTGTGCCTATCTCTGCCCATGACCCGCACTACCATACCTCAATCTGGTATGTTGCCCTTTCTGGAGTTTCTGAT
GAAGCATATATGAAGATCGTATGTGAGACGCACGAAGAGGCAAGGTCTCAGTATCACGAGGCGTCTGTGCTCCGG
CACGTCCTTAAACACCTACGCAAGCGGCGCTTCCTTACCCCTTTCGCCGACATCCTCTCGCGCTGTGGTATTCAG
CTCGAGCACCCGCGTGTGACAGACCTATACGACAATATCGTGCTCCAGGGAAACTGGCCCCACTCGGAAGAGCTC
CTCCAGCTCCTCGTATCCGAGGGCCTGTTTGATGAGCACCAGCGCGCTAGCCCTCCCCGCGCAGAGTGGACGCGG
CTACATGGCTTGGATGCTGACGGCGACGCACCATGTAGGCGGGGAGGACACGCGATGTGCATGGATGAGGAGAAC
GGGCTGATCTACCTCTTCGGCGGATGGGACGGCCAGCGCAACCTGGACGACTTCTGGGTATACGACGTGCGTGCG
GACGTATGGCGTCTACTGAGCCTTGCAACTGGTCGCGATCTGAATGGCCCAGGCCCGCGCTCGTGCCACAAGATG
GCCTTTGACAGGAAAACGGGATCGATCTACGTCTTGGGACGGCTGCTCGATAGCGATGACGTCGATCAGCCCGCG
ATGAACAGTGGAAGCGTTAATTCTCCTAGTGATAGTTCAGGCGTGCCGGACATACGCGCTGCTTCGGCATCGCAC
GCGGTCGATATCCCACGAGCAGGGAGCGTTACGCGACTCGTATGGCCTTCCACCCCGTCTGAGTTCTATCGATAC
CATACGCGCGGTCTTGATGCGGGAAAGTGGGACTTGTTGACCATGGACACCCAGGTGTGTGGAGGACCGCCATTG
ATATATGATCATCAAATGGTGGTGGATTCCGAGGCGCAAGGGTCTTGGAAAGAGCTCAGAGTTCCTGGGGCAATT
CCCACTGTCTTCCAGCGATTCGGGCACTCAATGTTACTGGAACCATCGTCTCACACACTTATCATACTTGCCGGC
CAGTACAGAGAGCAGTACGCGGCCGACATGCATGCGTATCATATACCGACCGGCACATTGACAGAACTGTTCCCG
AGTGTCACTGCTTCAGGCGGACCGGAAGCATGTTTCACACAGCGCGCAGCTATTGATCCAGACCTCAAAGAGATT
TACGTATTTTATGGACTCATACGCGATAGTCCCGGGGTTACTGTGCTCGACCCTGCGTCATCCGTGTGGGTATAT
CGTTACGACCGGCCAGACCGCCCGGGAAAATGGAGCAACACCTCGCCGGCCAACACCTCTGGTGGGAATTCTCCC
CATGGCGATCCAATCAGCGCGGAGACACCACAGCCGCGCTACGCCCACCAGGTTGTCTACGATCGACGCAGCAAA
ATCGCATATATGCATGGTGGAACCTCTGGAGTCGTGACTAATGTAGCCAGGACCCCAAGTGAATGGACGGGAGAT
TGGCCAGTACAAGCATTGGAGGGCCTATGTGCCGTAACGGAGGTCCGGCTCGACGATTTCTGGAAGCTGCGGTTG
GAGCGGCCGGCCTTATCGGATATTCTACGTCGTGGCCTATTTGAACTACGGCGTCAACACTTCCGCGAGCTATGC
GAGGATGCACCGCCTGTGAAGGCACTCACATTCTTGCAGAGAGAAGTGTCGGCCGTTGTAGATCACAGGATTCAG
GAAGAGGCACACGATTTTCACTCTTTATTGTCGCATCTCCTGGCTGTGCCGCCAGGAACATCGTCAGAAACAGAC
ACCTCGACCCAATCCTCGTCGCAAGACGCAGATATGCCGAATACCGAAGCACCTAGGGAAGAATTGATGGACGGG
CCCCCCGCCTTGGTATATACGATGGAAGTGGATCCACAAGAAACGAGCAGAGGCGATTCACCCTCTCCGGCAAGA
TTCAAACAACGGACGGAGCTGTTCGAGAAATTGCTTATATTCGTGAATACGAGCGCAAAAGAGCCTGAGAAGGAT
TTATCGGAATTAGTCAACACGGATAGGGAGGATTGA
Gene >RhoplFPRL280|82_2
ATGAAAACGTTCAAGGTCTACGTTGGGCAAACTGAGGACAACATGATTGAAGTATATATCTACTGCTCAGGCTGA
ACGCGTCGTATTCACAAGATCGACAGGCCATCAGTGGTGCCCTCAAGAACGATCCCGAAAAGGAGACTTTCTCCA
TCCGGCACAGAAGCAGTGCTGGCATTTTCTTCCCTACTCGCTATGTTAAGATTGTGCCTATCTCGTGCGTCTTGT
TCATCTTATGGAGGTGTACGCCGACTGACCGCGTGTGTTGTCTGACCCAAGTGCCCATGACCCGCACTACCATAC
CTCAATCTGGTATGTTGCCCTTTCTGGAGTTTCTGATGAAGCATATATGAAGATCGTATGTGAGACGCACGAAGA
GGCAAGGTCTCAGGTCGATTACCGTTTTACGACATACTGAGTGGATCATTTTCCAGTATCACGAGGCGTCTGTGC
TCCGGCACGTCCTTAAACACCTACGCAAGCGGCGCTTCCTTACCCCTTTCGCCGACATCCTCTCGCGCTGTGGTA
TTCAGCTCGAGCACCCGCGTGTGACAGACCTATACGACAATATCGTGCTCCAGGGAAACTGGCCCCACTCGGAAG
AGCTCCTCCAGCTCCTCGTATCCGAGGGCCTGTTTGATGAGCACCAGCGCGCTAGCCCTCCCCGCGCAGAGTGGA
CGCGGCTACATGGCTTGGATGCTGACGGCGACGCACCATGTAGGCGGGGAGGACACGCGATGTGCATGGATGAGG
AGAACGGGCTGATCTACCTCTTCGGCGGATGGGACGGCCAGCGCAACCTGGACGACTTCTGGGTATACGACGTGC
GTGCGGACGTATGGCGTCTACTGAGCCTTGCAACTGGTCGCGATCTGAATGGCCCAGGCCCGCGCTCGTGCCACA
AGATGGCCTTTGACAGGAAAACGGGATCGATCTACGTCTTGGGACGGCTGCTCGATAGCGATGACGTCGATCAGC
CCGCGATGAACAGTGGAAGCGTTAATTCTCCTAGTGATAGTTCAGGCGTGCCGGACATACGCGCTGCTTCGGCAT
CGCACGCGGTCGATATCCCACGAGCAGGGAGCGTTACGCGACTCGTATGGCCTTCCACCCCGTCTGAGTTCTATC
GATACCATACGCGCGGTCTTGATGCGGGAAAGTGGGACTTGTTGACCATGGACACCCAGGTCTCGTATAGTCTCA
ATCATCTGTAATTGCATACCTAATCACTCGTTTAGCAGGTGTGTGGAGGACCGCCATTGATATATGATCATCAAA
TGGTGGTGGATTCCGAGGCGCAAGTGATCTATGTCTCGGGGGGACGCATTTTTGACAGAGAACTGCGCATGAACA
AATACATAGGCCTTTTTGCATACGACATTCGCAAAGGGTCTTGGAAAGAGCTCAGGTCAGCGATCCCCCAGCCTT
CTCGTAAAACCATGTACTAAATATACTGCAGAGTTCCTGGGGCAATTCCCACTGTCTTCCAGCGATTCGGTGCGT
GAATTGTGTCGATGTAGGTCTGATTCGGCGCTGATTCGTCATGGCACAGGGCACTCAATGTTACTGGAACCATCG
TCTCACACACTTATCATACTTGCCGGCCAGTACAGAGAGCAGTACGCGGCCGACATGCATGCGTATCATATACCG
ACCGGCACATTGACAGAACTGTTCCCGAGTGTCACTGCTTCAGGCGGACCGGAAGCATGTTTCACACAGCGCGCA
GCTATTGATCCAGACCTCAAAGAGATTTACGTGTGAGTAGCTGCACGTATAACATCGTGATTGCCTTGGCTGATA
GCTCCTCTGCTATATGATAGATTTTATGGACTCATACGCGATAGTCCCGGGGTTACTGTGCTCGACCCTGCGTCA
TCCGTGTGGGTATATCGTTACGACCGGCCAGACCGCCCGGGAAAATGGAGCAACACCTCGCCGGCCAACACCTCT
GGTGGGAATTCTCCCCATGGCGATCCAATCAGCGCGGAGACACCACAGCCGCGCTACGCCCACCAGGTTGTCTAC
GATCGACGCAGCAAAATCGCATATATGCATGGTGGAACCTCTGGAGTCGTGACTAATGTAGCCAGGACCCCAAGT
GAATGGACGGGAGATTGGCCAGTACAAGCATTGGAGGGCCTATGTGCCGTAACGGAGGTCCGGCTCGACGATTTC
TGGAAGCTGCGGTTGGAGCGGTATGTCGACCATACGTTGCGAAGACAATTTCTCAGTCAATCTCTTGTAGGCCGG
CCTTATCGGATATTCTACGTCGTGGCCTATTTGAACTACGGCGTCAACAGTGAGTGGCTACGGTGCTTATTTGAC
CGTACAGTTCTCTCACCCTCCGCTCCAATCTCCTTCAAAAAAGCTTCCGCGAGCTATGCGAGGATGCACCGCCTG
TGAAGGCACTCACATTCTTGCAGAGAGAAGTGTCGGCCGTTGTAGATCACAGGATTCAGGAAGAGGCACACGATT
TTCACTCTTTATTGTCGCATCTCCTGGCTGTGCCGCCAGGAACATCGTCAGAAAGTAGGCTGCTCGTGACTTCAG
TTTCAGATCCGCTCGGGCAATGCCGCCTAACATTTCTTCCATGGCAGACACCTCGACCCAATCCTCGTCGCAAGA
CGCAGATATGCCGAATACCGAAGCACCTAGGGAAGAATTGATGGACGGGCCCCCCGCCTTGGTATATACGATGGA
AGTGGATCCACAAGAAACGAGCAGAGGCGATTCACCCTCTCCGGCAAGATTCAAACAACGGACGGAGCTGTTCGA
GAAATTGCTTATATTCGTGAATACGAGCGCAAAAGAGCCTGAGAAGGATTTATCGGAATTAGTCAACACGGATAG
GGAGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail