Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|81_15
Gene name
LocationNODE_81:91160..91987
Strand+
Gene length (bp)827
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999281

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup7246
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|028790
Agaricus bisporus var bisporus H97 AgabiH97|028790
Rhodonia placenta FPRL280 RhoplFPRL280|81_15 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|81_15
MLGMSLLFSTLLFTTLARAGLYGTRPIANTVLSSGRLSSVNWINDNTAPSLKEMGPMRIDLYRSGDIFVATLADN
VEPTSRSHKVWISPTWGPNGSDYHMRFTCEDPPLTIYTADFTVTAMDDTPRYQGSENAVADSEASIGTSYATPSA
TTATYSLPTMYSQLYTSSSSAVSSTPSMTRVSSTSVNTASAASTGTGNPYMNKAKTGAGGGSWMRTSVDLERVKF
RLVFVLWPVLIGLTLAL*
Coding >RhoplFPRL280|81_15
ATGCTGGGCATGTCTTTGCTTTTCTCCACGCTTCTATTCACTACACTAGCTCGTGCGGGACTCTATGGGACTAGG
CCGATTGCGAACACTGTTCTGAGTTCTGGCCGCTTGTCGTCTGTAAACTGGATCAACGATAATACCGCACCATCT
CTTAAAGAAATGGGCCCAATGCGCATTGACCTATATCGCTCAGGCGACATCTTCGTTGCCACTTTGGCGGACAAC
GTCGAACCGACCAGCAGATCCCACAAAGTATGGATCTCCCCGACTTGGGGACCTAATGGCTCAGACTATCACATG
CGCTTCACCTGCGAAGACCCTCCGCTCACAATCTATACGGCCGACTTCACCGTCACGGCAATGGACGACACGCCT
CGCTACCAGGGGTCGGAGAATGCTGTGGCAGACTCAGAGGCATCTATCGGCACAAGCTATGCTACGCCATCCGCA
ACTACCGCCACATACTCCCTACCAACAATGTACTCACAGCTATACACAAGCTCGAGCTCGGCTGTGTCCTCAACG
CCATCAATGACCCGCGTTTCCAGTACTTCTGTTAATACTGCCTCTGCCGCCAGTACCGGCACGGGAAACCCTTAT
ATGAACAAAGCGAAGACTGGTGCGGGCGGTGGCTCATGGATGCGAACGTCGGTGGACCTCGAACGTGTCAAGTTC
CGTCTAGTCTTCGTCCTCTGGCCGGTACTCATCGGACTCACGCTGGCGCTATGA
Transcript >RhoplFPRL280|81_15
ATGCTGGGCATGTCTTTGCTTTTCTCCACGCTTCTATTCACTACACTAGCTCGTGCGGGACTCTATGGGACTAGG
CCGATTGCGAACACTGTTCTGAGTTCTGGCCGCTTGTCGTCTGTAAACTGGATCAACGATAATACCGCACCATCT
CTTAAAGAAATGGGCCCAATGCGCATTGACCTATATCGCTCAGGCGACATCTTCGTTGCCACTTTGGCGGACAAC
GTCGAACCGACCAGCAGATCCCACAAAGTATGGATCTCCCCGACTTGGGGACCTAATGGCTCAGACTATCACATG
CGCTTCACCTGCGAAGACCCTCCGCTCACAATCTATACGGCCGACTTCACCGTCACGGCAATGGACGACACGCCT
CGCTACCAGGGGTCGGAGAATGCTGTGGCAGACTCAGAGGCATCTATCGGCACAAGCTATGCTACGCCATCCGCA
ACTACCGCCACATACTCCCTACCAACAATGTACTCACAGCTATACACAAGCTCGAGCTCGGCTGTGTCCTCAACG
CCATCAATGACCCGCGTTTCCAGTACTTCTGTTAATACTGCCTCTGCCGCCAGTACCGGCACGGGAAACCCTTAT
ATGAACAAAGCGAAGACTGGTGCGGGCGGTGGCTCATGGATGCGAACGTCGGTGGACCTCGAACGTGTCAAGTTC
CGTCTAGTCTTCGTCCTCTGGCCGGTACTCATCGGACTCACGCTGGCGCTATGA
Gene >RhoplFPRL280|81_15
ATGCTGGGCATGTCTTTGCTTTTCTCCACGCTTCTATTCACTACACTAGCTCGTGCGGGACTCTATGGGACTAGG
CCGATTGCGAACACTGTTCTGAGTTCTGGCCGCTTGTCGTCTGTAAACTGGATCAACGATAATACCGCACCATCT
CTTAAAGAAATGGGCCCAATGCGCATTGACCTATATCGCTCAGGCGACGTGAGTATTCTCACATGAGTTGGATGG
CAAACCTTCATTAGACTACAGATCTTCGTTGCCACTTTGGCGGACAACGTCGAACCGACCAGCAGATCCCACAAA
GTATGGATCTCCCCGACTTGGGGACCTAATGGCTCAGACTAGTATGTTTTACACCGTCCTTGAGCAGTGACAGGC
CAACGAGGCGTTACAGTCACATGCGCTTCACCTGCGAAGACCCTCCGCTCACAATCTATACGGCCGACTTCACCG
TCACGGCAATGGACGACACGCCTCGCTACCAGGGGTCGGAGAATGCTGTGGCAGACTCAGAGGCATCTATCGGCA
CAAGCTATGCTACGCCATCCGCAACTACCGCCACATACTCCCTACCAACAATGTACTCACAGCTATACACAAGCT
CGAGCTCGGCTGTGTCCTCAACGCCATCAATGACCCGCGTTTCCAGTACTTCTGTTAATACTGCCTCTGCCGCCA
GTACCGGCACGGGAAACCCTTATATGAACAAAGCGAAGACTGGTGCGGGCGGTGGCTCATGGATGCGAACGTCGG
TGGACCTCGAACGTGTCAAGTTCCGTCTAGTCTTCGTCCTCTGGCCGGTACTCATCGGACTCACGCTGGCGCTAT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail