Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|731_1
Gene name
LocationNODE_731:1660..3787
Strand-
Gene length (bp)2127
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13679 Methyltransf_32 Methyltransferase domain 4.4E-12 217 381

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup6900
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|102590
Agaricus bisporus var bisporus H97 AgabiH97|102590
Rhodonia placenta FPRL280 RhoplFPRL280|157_6
Rhodonia placenta FPRL280 RhoplFPRL280|731_1 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|731_1
MSTSDSLHSVHAFLCAPIVNELLTTHPNWLCQNAESHTLSSEISSWWEWAGERPHGYSTANGPQVLPPVGEHKWL
LLLRYYTHPYCDDLSDFYSSIPADLRELLDTARRLQLSREPGPARFLASSCPRNATREAVYQSVDYETFGIEAAN
DDRIVGMSPKKAHEVLRMTAYTSWLLGSSPRLRTIRHVVDVGAGQFLVRSTILRFLCVDHRVLVLEQAYLSRSLR
DKIGLNVLALDWSDVQSQGAVRREAIGKKRRKKEIPTPAEDESSIPQVNDSNTPPVKQQPGALTYMTLRITTDTL
LSSVDEWFHRGDEITTPEKHENLYADGEPTPALFVALHACGSLTPNILRAFLARLKSSDGDQKWSPQAAIVVGCC
YNLLEASDFPLSHELTHSTSGLPPAYLTNNHLQLAAQVPSQWMRSEVASAASHLAIRKVVWRALLAGILVQVPIP
LADITKQADDDDYCPIHLRRLGKLNDSVYDDWDTFLARAGEKLGVDLMQGHPRDREMESRLEVMHVLRCILGPVV
ESFILLDRLQWLKEELRGTGMDVELVNLFNQASGSGRNVAIVISPQLHETYVQ*
Coding >RhoplFPRL280|731_1
ATGTCAACGTCTGATTCTCTACACAGCGTTCATGCTTTTCTCTGCGCTCCCATCGTCAATGAACTACTGACGACA
CATCCAAACTGGCTTTGTCAAAATGCTGAATCGCATACGCTCTCATCAGAGATATCATCTTGGTGGGAATGGGCT
GGCGAGCGTCCCCACGGATATTCTACAGCAAACGGTCCGCAGGTGCTTCCGCCGGTCGGCGAACACAAATGGCTC
CTATTGCTGCGCTACTACACTCATCCTTACTGTGACGATCTAAGCGACTTTTATTCATCTATACCGGCCGATCTC
AGAGAGCTCCTGGACACCGCCCGTCGTCTGCAGTTGTCACGCGAGCCTGGCCCCGCACGCTTCCTCGCGTCATCA
TGCCCACGAAATGCAACGCGAGAAGCCGTCTATCAATCTGTGGATTACGAAACCTTTGGAATCGAGGCCGCCAAT
GATGACCGCATTGTCGGCATGTCGCCCAAGAAGGCGCACGAAGTCCTCCGCATGACAGCATACACCTCGTGGCTT
CTCGGTTCTTCGCCGAGGTTAAGGACAATCAGGCATGTTGTCGATGTTGGTGCGGGTCAATTCTTGGTCCGCTCA
ACCATTCTGCGGTTCCTGTGTGTTGACCATCGCGTACTTGTGCTTGAACAGGCATATTTGTCACGAAGCTTGCGG
GATAAAATTGGTCTGAACGTTCTTGCACTTGACTGGAGCGACGTACAATCCCAAGGTGCCGTGCGACGGGAGGCC
ATTGGCAAGAAGAGACGCAAGAAAGAGATCCCTACTCCAGCTGAAGATGAGTCCTCGATCCCGCAAGTGAATGAC
AGCAATACCCCGCCAGTAAAACAGCAACCAGGCGCGTTGACGTACATGACCCTCAGAATCACGACCGACACACTT
TTGTCCTCTGTTGACGAGTGGTTCCATCGAGGGGATGAGATAACGACACCAGAGAAGCATGAAAATCTGTATGCG
GATGGAGAACCGACGCCAGCACTATTCGTGGCACTGCATGCATGCGGATCTCTTACGCCGAACATTCTGCGTGCA
TTCCTGGCACGTCTGAAATCTAGCGACGGGGATCAGAAGTGGTCTCCACAAGCGGCCATTGTGGTCGGTTGCTGT
TACAATCTGCTCGAGGCCTCAGATTTCCCGCTCTCCCATGAACTCACGCATTCCACCTCAGGGCTACCTCCTGCC
TATCTGACCAACAACCACCTCCAGCTCGCCGCACAAGTTCCCTCGCAATGGATGCGATCTGAGGTAGCATCCGCT
GCATCGCACCTCGCGATACGCAAAGTTGTGTGGCGGGCCCTCCTTGCAGGTATCCTTGTGCAGGTGCCGATTCCG
CTTGCCGATATTACCAAGCAAGCCGACGACGATGACTACTGCCCAATACACCTTCGCCGCCTCGGCAAGCTGAAC
GACTCTGTGTACGACGATTGGGACACGTTTCTCGCACGGGCCGGGGAGAAACTAGGTGTAGACCTGATGCAGGGG
CACCCGAGGGATCGGGAAATGGAGAGCCGCCTTGAAGTCATGCATGTGTTGAGATGTATATTGGGACCGGTCGTG
GAGAGCTTTATCCTGCTCGACCGGTTGCAGTGGCTGAAGGAGGAGTTACGGGGTACGGGGATGGACGTCGAATTG
GTTAATTTGTTCAATCAGGCCTCGGGAAGTGGCAGGAATGTCGCTATTGTCATCTCCCCTCAGCTGCACGAAACA
TATGTCCAATGA
Transcript >RhoplFPRL280|731_1
ATGTCAACGTCTGATTCTCTACACAGCGTTCATGCTTTTCTCTGCGCTCCCATCGTCAATGAACTACTGACGACA
CATCCAAACTGGCTTTGTCAAAATGCTGAATCGCATACGCTCTCATCAGAGATATCATCTTGGTGGGAATGGGCT
GGCGAGCGTCCCCACGGATATTCTACAGCAAACGGTCCGCAGGTGCTTCCGCCGGTCGGCGAACACAAATGGCTC
CTATTGCTGCGCTACTACACTCATCCTTACTGTGACGATCTAAGCGACTTTTATTCATCTATACCGGCCGATCTC
AGAGAGCTCCTGGACACCGCCCGTCGTCTGCAGTTGTCACGCGAGCCTGGCCCCGCACGCTTCCTCGCGTCATCA
TGCCCACGAAATGCAACGCGAGAAGCCGTCTATCAATCTGTGGATTACGAAACCTTTGGAATCGAGGCCGCCAAT
GATGACCGCATTGTCGGCATGTCGCCCAAGAAGGCGCACGAAGTCCTCCGCATGACAGCATACACCTCGTGGCTT
CTCGGTTCTTCGCCGAGGTTAAGGACAATCAGGCATGTTGTCGATGTTGGTGCGGGTCAATTCTTGGTCCGCTCA
ACCATTCTGCGGTTCCTGTGTGTTGACCATCGCGTACTTGTGCTTGAACAGGCATATTTGTCACGAAGCTTGCGG
GATAAAATTGGTCTGAACGTTCTTGCACTTGACTGGAGCGACGTACAATCCCAAGGTGCCGTGCGACGGGAGGCC
ATTGGCAAGAAGAGACGCAAGAAAGAGATCCCTACTCCAGCTGAAGATGAGTCCTCGATCCCGCAAGTGAATGAC
AGCAATACCCCGCCAGTAAAACAGCAACCAGGCGCGTTGACGTACATGACCCTCAGAATCACGACCGACACACTT
TTGTCCTCTGTTGACGAGTGGTTCCATCGAGGGGATGAGATAACGACACCAGAGAAGCATGAAAATCTGTATGCG
GATGGAGAACCGACGCCAGCACTATTCGTGGCACTGCATGCATGCGGATCTCTTACGCCGAACATTCTGCGTGCA
TTCCTGGCACGTCTGAAATCTAGCGACGGGGATCAGAAGTGGTCTCCACAAGCGGCCATTGTGGTCGGTTGCTGT
TACAATCTGCTCGAGGCCTCAGATTTCCCGCTCTCCCATGAACTCACGCATTCCACCTCAGGGCTACCTCCTGCC
TATCTGACCAACAACCACCTCCAGCTCGCCGCACAAGTTCCCTCGCAATGGATGCGATCTGAGGTAGCATCCGCT
GCATCGCACCTCGCGATACGCAAAGTTGTGTGGCGGGCCCTCCTTGCAGGTATCCTTGTGCAGGTGCCGATTCCG
CTTGCCGATATTACCAAGCAAGCCGACGACGATGACTACTGCCCAATACACCTTCGCCGCCTCGGCAAGCTGAAC
GACTCTGTGTACGACGATTGGGACACGTTTCTCGCACGGGCCGGGGAGAAACTAGGTGTAGACCTGATGCAGGGG
CACCCGAGGGATCGGGAAATGGAGAGCCGCCTTGAAGTCATGCATGTGTTGAGATGTATATTGGGACCGGTCGTG
GAGAGCTTTATCCTGCTCGACCGGTTGCAGTGGCTGAAGGAGGAGTTACGGGGTACGGGGATGGACGTCGAATTG
GTTAATTTGTTCAATCAGGCCTCGGGAAGTGGCAGGAATGTCGCTATTGTCATCTCCCCTCAGCTGCACGAAACA
TATGTCCAATGA
Gene >RhoplFPRL280|731_1
ATGTCAACGTCTGATTCTCTACACAGCGTTCATGCTTTTCTCTGCGCTCCCATCGTCAATGAACTACTGACGACA
CATCCAAACTGGCTTTGTCAAAATGCTGAATCGCATACGCTCTCATCAGAGATATCATCTTGGTGGGAATGGGCT
GGCGAGCGTCCCCACGGATATTCTACAGCAAACGGTCCGCAGGTGCTTCCGCCGGTCGGCGAACACAAATGGCTC
CTATTGCTGCGCTACTACACTCATCCTTACTGTGACGATCTAAGCGACTTTTATTCATCTATACCGGCCGATCTC
AGAGAGCTCCTGGACACCGCCCGTCGTCTGCAGTTGTCACGCGAGCCTGGCCCCGCACGCTTCCTCGCGTCATCA
TGCCCACGAAATGCAACGCGAGAAGCCGTCTATCAATCTGTGGATTACGAAACCTTTGGAATCGAGGCCGCCAAT
GATGACCGCATTGTCGGCATGTCGCCCAAGAAGGCGCACGAAGTCCTCCGCATGACAGCATACACCTCGTGGCTT
CTCGGTTCTTCGCCGAGGTTAAGGACAATCAGGCATGTTGTCGATGTTGGTGCGGGTCAAGTTCGTTCTATCTAT
CCTACGTCTCTTCTCTATCACATTTTTTACTACAAGCGTGCGGTTCTCTATTAGCATCTTTTCCACTTCGATTGC
ATTATTCGATGTGGCATAAATGCTGAAACGGCGTCACTGGAGTCATTTCAGTCGTGCCGTTGGGCGCGAATCCCT
TGCCGTCATTTTTTCCGCTTTCGACGGAGATCCTTCCTGCGTATATTTTGTTTACCATCGTTTGAGTGACGTTAT
GTTTGTCTAACTATGTATATGGCTGTTTTGCTTCAAATTCTTGGTCCGCTCAACCATTCTGCGGTTCCTGTGTGT
TGACCATCGCGTACTTGTGCTTGAACAGGCATATTTGTCACGAAGCTTGCGGGATAAAATTGGTCTGAACGTTCT
TGCACTTGACTGGAGCGACGTACAATCCCAAGGTGCCGTGCGACGGGAGGCCATTGGCAAGAAGAGACGCAAGAA
AGAGATCCCTACTCCAGCTGAAGATGAGTCCTCGATCCCGCAAGTGAATGACAGCAATACCCCGCCAGTAAAACA
GCAACCAGGCGCGTTGACGTACATGACCCTCAGAATCACGACCGACACACTTTTGTCCTCTGTTGACGAGTGGTT
CCATCGAGGGGATGAGATAACGACACCAGAGAAGCATGAAAATCTGTATGCGGATGGAGAACCGACGCCAGCACT
ATTCGTGGCACTGCATGCATGCGGATCTCTTACGCCGAACATTCTGCGTGCATTCCTGGCACGTCTGAAATCTAG
CGACGGGGATCAGAAGTGGTCTCCACAAGCGGCCATTGTGGTCGGTTGCTGTTACAATCTGCTCGAGGCCTCAGG
TATGTTCGACTACACATTTCGAATGTGACTCATTGTCGCTCATGAGTTCCGTCAACAGATTTCCCGCTCTCCCAT
GAACTCACGCATTCCACCTCAGGGCTACCTCCTGCCTATCTGACCAACAACCACCTCCAGCTCGCCGCACAAGTT
CCCTCGCAATGGATGCGATCTGAGGTAGCATCCGCTGCATCGCACCTCGCGATACGCAAAGTTGTGTGGCGGGCC
CTCCTTGCAGGTATCCTTGTGCAGGTGCCGATTCCGCTTGCCGATATTACCAAGCAAGCCGACGACGATGACTAC
TGCCCAATACACCTTCGCCGCCTCGGCAAGCTGAACGACTCTGTGTACGACGATTGGGACACGTTTCTCGCACGG
GCCGGGGAGAAACTAGGTGTAGACCTGATGCAGGGGCACCCGAGGGATCGGGAAATGGAGAGCCGCCTTGAAGTC
ATGCATGTGTTGAGATGTATATTGGGACCGGTCGTGGAGAGCTTTATCCTGCTCGACCGGTTGCAGTGGCTGAAG
GAGGAGTTACGGGTGAGTCTTTTCCATTGCTGTCTGGGTGAACTAGTTTGTGAACATGGTATGAAGGGTACGGGG
ATGGACGTCGAATTGGTTAATTTGTTCAATCAGGCCTCGGGAAGTGGCAGGAATGTCGCTATTGTCATCTCCCCT
CAGCTGCACGAAACATATGTCCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail