Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|594_2
Gene name
LocationNODE_594:7428..8942
Strand+
Gene length (bp)1514
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 1.5E-08 65 140
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.6E-07 61 294
PF03435 Sacchrp_dh_NADP Saccharopine dehydrogenase NADP binding domain 6.7E-06 61 135
PF05368 NmrA NmrA-like family 1.5E-05 61 136

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup152
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|071030
Agaricus bisporus var bisporus H39 AgabiH39|071040
Agaricus bisporus var bisporus H39 AgabiH39|083920
Agaricus bisporus var bisporus H97 AgabiH97|071030
Agaricus bisporus var bisporus H97 AgabiH97|071040
Agaricus bisporus var bisporus H97 AgabiH97|083920
Rhodonia placenta FPRL280 RhoplFPRL280|233_5
Rhodonia placenta FPRL280 RhoplFPRL280|287_8
Rhodonia placenta FPRL280 RhoplFPRL280|335_4
Rhodonia placenta FPRL280 RhoplFPRL280|335_6
Rhodonia placenta FPRL280 RhoplFPRL280|335_7
Rhodonia placenta FPRL280 RhoplFPRL280|509_3
Rhodonia placenta FPRL280 RhoplFPRL280|594_2 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|594_2
MHIDESCCFINYREAYRAGSPQCISILALAATFNGHQPDSTSYSNTNTYQSNVISPSKTNIFLIGATGYIGGSVL
TRLLNHASANTFDITVLVRSAEKAKVLQEKFDIKAVVGSNDDLDKLEALSEQSHVVFSCADAGNLAAIQVILHSL
KKRHTSTGDLSILIHTSGTAVIATQAKGMFSSVTIYSDTDVDQVKSIPPTAPHKDVDLAVIAADEEGYARTYTIL
PSTIYGQAKGPLFDAGISNSTSIQIPYLIRAALGRKQGGVVGQGKAIWLDVHIDDVLDLYIVLLDAITANQAGVG
HGWEGIYFGKNGEHTWYDISKAISKVLVELGVGGTDEPTSFADEELAKYWGSVDVGNFDGMNARCRANRGRSIGW
KPKYTTADMLASIKPEVALLWEKAQKEGGV*
Coding >RhoplFPRL280|594_2
ATGCACATTGATGAATCATGCTGCTTCATCAACTATCGAGAAGCTTACAGAGCAGGTTCTCCTCAATGTATATCA
ATCCTTGCGTTGGCTGCAACTTTCAACGGTCATCAGCCAGACTCAACAAGTTATTCGAACACAAACACATACCAA
TCCAACGTAATATCGCCTTCGAAGACCAACATCTTCCTGATCGGCGCGACAGGCTACATTGGCGGCTCTGTCCTC
ACACGCCTTCTTAACCACGCCAGTGCGAACACCTTTGACATTACCGTGCTTGTACGCTCTGCGGAGAAGGCAAAG
GTGCTCCAGGAGAAGTTCGACATCAAGGCCGTCGTGGGCTCCAATGACGACCTCGACAAGCTCGAGGCACTCTCT
GAACAATCGCACGTCGTCTTCTCCTGCGCAGATGCAGGCAACCTTGCCGCCATTCAGGTGATCCTGCACAGCTTG
AAGAAGCGGCACACGTCGACTGGAGATCTTTCCATTCTGATTCACACTTCGGGCACGGCTGTGATCGCCACACAG
GCCAAGGGCATGTTCAGCTCGGTCACCATCTACTCTGACACCGACGTCGACCAGGTCAAGTCTATACCCCCCACC
GCACCGCACAAGGATGTCGATCTTGCTGTTATTGCTGCTGACGAAGAAGGCTACGCACGGACCTATACCATCCTA
CCGTCGACCATCTACGGCCAGGCGAAGGGCCCCCTATTCGACGCCGGCATCTCGAACTCAACCTCTATCCAGATT
CCATACCTCATTCGCGCGGCGCTCGGCCGCAAGCAGGGTGGCGTCGTCGGCCAGGGCAAGGCGATCTGGCTGGAT
GTCCACATCGACGATGTGTTGGACCTGTACATCGTTCTGCTCGATGCGATCACGGCAAACCAGGCGGGCGTCGGC
CACGGCTGGGAAGGCATCTATTTCGGCAAGAATGGCGAGCACACATGGTACGACATCAGCAAGGCGATCTCGAAG
GTGCTGGTCGAGCTCGGTGTCGGTGGCACGGACGAGCCGACTAGCTTCGCAGACGAGGAGCTCGCGAAGTACTGG
GGCTCAGTGGATGTGGGGAACTTTGATGGCATGAACGCGCGTTGCAGGGCTAACCGTGGCCGGTCGATTGGTTGG
AAACCGAAGTACACGACGGCGGATATGCTTGCGAGCATCAAGCCTGAGGTTGCGCTGTTGTGGGAAAAGGCCCAG
AAGGAGGGTGGCGTATAG
Transcript >RhoplFPRL280|594_2
ATGCACATTGATGAATCATGCTGCTTCATCAACTATCGAGAAGCTTACAGAGCAGGTTCTCCTCAATGTATATCA
ATCCTTGCGTTGGCTGCAACTTTCAACGGTCATCAGCCAGACTCAACAAGTTATTCGAACACAAACACATACCAA
TCCAACGTAATATCGCCTTCGAAGACCAACATCTTCCTGATCGGCGCGACAGGCTACATTGGCGGCTCTGTCCTC
ACACGCCTTCTTAACCACGCCAGTGCGAACACCTTTGACATTACCGTGCTTGTACGCTCTGCGGAGAAGGCAAAG
GTGCTCCAGGAGAAGTTCGACATCAAGGCCGTCGTGGGCTCCAATGACGACCTCGACAAGCTCGAGGCACTCTCT
GAACAATCGCACGTCGTCTTCTCCTGCGCAGATGCAGGCAACCTTGCCGCCATTCAGGTGATCCTGCACAGCTTG
AAGAAGCGGCACACGTCGACTGGAGATCTTTCCATTCTGATTCACACTTCGGGCACGGCTGTGATCGCCACACAG
GCCAAGGGCATGTTCAGCTCGGTCACCATCTACTCTGACACCGACGTCGACCAGGTCAAGTCTATACCCCCCACC
GCACCGCACAAGGATGTCGATCTTGCTGTTATTGCTGCTGACGAAGAAGGCTACGCACGGACCTATACCATCCTA
CCGTCGACCATCTACGGCCAGGCGAAGGGCCCCCTATTCGACGCCGGCATCTCGAACTCAACCTCTATCCAGATT
CCATACCTCATTCGCGCGGCGCTCGGCCGCAAGCAGGGTGGCGTCGTCGGCCAGGGCAAGGCGATCTGGCTGGAT
GTCCACATCGACGATGTGTTGGACCTGTACATCGTTCTGCTCGATGCGATCACGGCAAACCAGGCGGGCGTCGGC
CACGGCTGGGAAGGCATCTATTTCGGCAAGAATGGCGAGCACACATGGTACGACATCAGCAAGGCGATCTCGAAG
GTGCTGGTCGAGCTCGGTGTCGGTGGCACGGACGAGCCGACTAGCTTCGCAGACGAGGAGCTCGCGAAGTACTGG
GGCTCAGTGGATGTGGGGAACTTTGATGGCATGAACGCGCGTTGCAGGGCTAACCGTGGCCGGTCGATTGGTTGG
AAACCGAAGTACACGACGGCGGATATGCTTGCGAGCATCAAGCCTGAGGTTGCGCTGTTGTGGGAAAAGGCCCAG
AAGGAGGGTGGCGTATAG
Gene >RhoplFPRL280|594_2
ATGCACATTGATGAATCATGCTGCTTCATCAACTATCGAGAAGCTTACAGAGCAGGTTCTCCTCAATGTATATCA
ATCCTTGCGTTGGCTGCAACTTTCAACGGTCATCAGCCAGACTCAACAAGTTATTCGAACACAAACACATACCAA
TCCAACGTAATATCGCCTTCGAAGACCAACATCTTCCTGATCGGCGCGACAGGTGCGTATCGGGTTGCCTTTTTC
ATTGAGATAAGGCAGCTCAGAATGCTGATTGCGATCTACAGGCTACATTGGCGGCTCTGTCCTCACACGCCTTCT
TAACCACGCCAGTGCGAACACCTTTGACATTACCGTGCTTGTACGCTCTGCGGAGAAGGCAAAGGTGCTCCAGGA
GAAGTTCGACATCAAGGCCGTCGTGGGCTCCAATGACGACCTCGACAAGCTCGAGGCACTCTCTGAACAATCGCA
CGTCGTCTTCTCCTGCGCAGATGCAGGCAACCTTGCCGCCATTCAGGTGATCCTGCACAGCTTGAAGAAGCGGCA
CACGTCGACTGGAGATCTTTCCATTCTGATTCACACTGTACGTGCTCATAAGACATCTACTCTGGCACTCAGCAC
TGACAGTGAGACTGGCAGTCGGGCACGGCTGTGATCGCCACACAGGCCAAGGGCATGTTCAGCTCGGTCACCATC
TACTCTGACACCGACGTCGACCAGGTCAAGTCTATACCCCCCACCGCACCGCACAAGGATGTCGATCTTGCTGTT
ATTGCTGCTGACGAAGAAGGTGTGTACCCGATAGCACTTACTTCTCTCCGTATCCATCGCACTCAAGCATAATTT
GCAGGCTACGCACGGACCTATACCATCCTACCGTCGACCATCTACGGCCAGGCGAAGGGCCCCCTATTCGACGCC
GGCATCTCGAACTCAACCTCTATCCAGATTCCATACCTCATTCGCGCGGCGCTCGGCCGCAAGCAGGGTGGCGTC
GTCGGCCAGGGCAAGGCGATCTGGCTGGATGTCCACATCGACGATGGTATGTCGCTGGCTATTCATCCTACCTGT
CGACCCGGTGCTGACCAGGTGTTCTCACAGTGTTGGACCTGTACATCGTTCTGCTCGATGCGATCACGGCAAACC
AGGCGGGCGTCGGCCACGGCTGGGAAGGCATCTATTTCGGCAAGAATGGCGAGCACACATGGTACGACATCAGCA
AGGCGATCTCGAAGGTGCTGGTCGAGCTCGGTGTCGGTGGCACGGACGAGCCGACTAGCTTCGCAGACGAGGAGC
TCGCGAAGTACTGGGGCTCAGTGGTAAGTTTCAGACATCCCCAGCCTATATCACAGACTTGCTGATGTTCCATCA
TGCAGGATGTGGGGAACTTTGATGGCATGAACGCGCGTTGCAGGGCTAACCGTGGCCGGTCGATTGGTTGGAAAC
CGAAGTACACGACGGCGGATATGCTTGCGAGCATCAAGCCTGAGGTTGCGCTGTTGTGGGAAAAGGCCCAGAAGG
AGGGTGGCGTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail