Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|465_1
Gene name
LocationNODE_465:4359..13723
Strand-
Gene length (bp)9364
Transcript length (bp)5262
Coding sequence length (bp)5262
Protein length (aa) 1754

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.0E-31 97 417
PF07993 NAD_binding_4 Male sterility protein 4.9E-14 730 835
PF07993 NAD_binding_4 Male sterility protein 7.5E-06 860 939
PF10250 O-FucT GDP-fucose protein O-fucosyltransferase 7.6E-08 1582 1740

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|465_1
MQQMTVLGTILCADMEDTSRTDDYRRLYFPLGCAKWWYPPAACSFGYSIPLAAPNGTFHKHDRNNTFQAHDEIHG
QSSTTFRPPPLDGLLLIPELWEWHARYSPDHPLFVFADEGGIVRRLCWPEVVRAIHTGAKIIRNRTNWKAGTAES
PTVAILANSDSISYATTLMAIIRAEYTGFLISTRNSPAAIAHLLNIVGVQHLLIGREPLVCELATKSLNILRARY
PCAHVPETSLALIFEELYLPNSETVSADDVPYERQKLEDPIIILHTSGSTAFPKPITLTHRRAIEIIITPCFVHV
LPMFHIMGMFFTMSAVSCGFIVSMFAPRSPAPVPTSDNIVDSFKATQCDLIFTVPSMIEVWSHNPDYIKLFATRM
GIAFGGGPLNKEVGDSLTARGVTLFTLYGATETGAACMVFVANVGGSWDYFRFPPHMTAKMVPSGEGTFELVIVP
GYWKVIGRTDDQIMHSTGEKTNPGPLESIMNTDRHVRASVMFGRGRFQVGILIEPQPGFVLDPSDEGSLTSFRNK
IWPTVEKMNTYAPQHSRLFKEMILVANPSKPFLYTSKNTVRRGAVIMEYEDDIDALYDAVDLSAQTSVTSPHEWS
LTTAIDYVRLVVHKVIAHSVMDDDDIFQHGCDSLQATYIRNIILGALRDTTKVNTRKISDSFVYDHPTISRLAAF
VSSVALGTHDAAAMGVNPSARILAMRAMLAKCSADFPARPHTLLPSQPKRDAVFVTGTTGSIGCHLLALLVADPK
VWRVYAFNRPAKTQTHLRERQKSALVERGLDASIADSEKVVLLEGSLTAENWGVGKNAYEELHRSVTHIIHNAWR
VDFVIKLESFEDSIADSPCDVKFAEGPSEPDLAVGTGYAESKWVSEQILYAAAYKASLNALVVRVGQVCGGLNGA
WNAHEWFPTLVQSTLELGCFPDDDKGVNWIPLEIAAGAIADFRHAANPTHTVHLVHPHPVSWHSLATVVSSELSV
PLVAYSAWLAKLEHTTQTHEHTGHGSTQIARSLRALQLLPFFRGITEKLGATRMSMGLPDLEVKQAMAGSPTLRA
PDLRQLGGEDVERWLAYWRTWRLPEGTEGVAPISGVDLLSDAKEILCTLAGRTRSTLCSSARSMSAARGGEEWFV
GFVQKFVAQRRGARKTKARLGLPPLRVLGLRAEAGNHSNGSAAASCTYMQIEEKRTLNKATAEANLGYSSGPQGN
DPFSARHATCVRFRHVNYQDERGQDDGGSHFQHPAADSTQQKAQKSMLNSRLPRGSQPDYDGELPRTNGLHQNKP
PFTRLTRRHFRFAVIALLVIAAVPLVLRLHAPLRRRFAGPAEPMGADAQEDTSEKPPLYGEWHQYEQDISRRQHF
PPNAKYLFTSTHTRGAGWGNAMQELIMHSYLAYRSGRTFTWYNYTWNDDGSDYTLYNGKHIPSRIPMSALLGGPI
VGEPYHTDPTAPQPASISEQYYREICTESERRKIDNGDIVAQLGGGYSATALLDKWVEVMAETDARCVEIPYESV
PLFDFWIMGDAGRLLNAWDGLAASPVLREFRWSPLVELAFDTNRETISPAQISAPYLTSLPADLGPRANPSATRY
APLPGLLAMHIRRGDFAGHCEHLGRWSSPWVGFNSFAALPDVLDTGRLPSDEAARIELYRTHCFPNIAEIVVRAE
ALRVAEAEGGRGELRDVYVMTNGPVEWVAELEAALKETGHWRHVASSRDLLVNQEQKYVKQAVDMLIGQRAQVFV
GNGWSSLTGLVSMLRMGNGINPKQTRML*
Coding >RhoplFPRL280|465_1
ATGCAGCAAATGACTGTATTGGGCACTATCCTCTGTGCAGACATGGAAGATACTTCAAGGACAGATGATTACAGA
CGTCTTTACTTCCCCTTGGGTTGTGCCAAATGGTGGTATCCACCGGCAGCATGCAGTTTCGGATACTCGATACCT
CTTGCTGCTCCTAACGGCACGTTTCACAAACATGATAGAAACAATACATTTCAGGCGCATGATGAAATTCATGGA
CAGTCGTCCACTACGTTCCGACCACCCCCGCTCGATGGTTTGCTGCTCATACCAGAGCTCTGGGAATGGCATGCG
CGGTACTCTCCAGATCATCCGCTTTTCGTCTTTGCAGATGAGGGTGGCATTGTCCGTCGACTATGCTGGCCCGAG
GTGGTGCGAGCCATCCACACCGGTGCTAAGATTATCAGAAATCGTACGAATTGGAAGGCCGGCACAGCTGAATCT
CCTACTGTGGCTATTCTGGCAAACTCAGACTCAATCTCATACGCGACAACCCTAATGGCTATTATTCGCGCTGAG
TACACAGGCTTCCTCATTTCTACGCGTAATTCTCCTGCGGCGATCGCACATCTGCTGAACATTGTCGGAGTCCAA
CATCTCCTTATCGGACGTGAACCGTTGGTCTGCGAGCTTGCCACCAAGTCGTTGAATATACTACGGGCGAGATAT
CCATGCGCGCACGTGCCTGAGACGTCACTCGCGCTGATTTTCGAAGAGCTCTATCTGCCCAACTCAGAAACCGTT
TCTGCTGATGATGTGCCCTACGAGCGTCAAAAACTCGAAGACCCTATCATTATTTTACACACGTCCGGTTCAACG
GCATTTCCGAAACCGATTACGCTCACACATCGTCGCGCCATTGAGATCATCATTACACCATGCTTCGTGCACGTC
CTGCCCATGTTCCATATCATGGGCATGTTCTTTACAATGTCGGCTGTTTCGTGTGGCTTCATTGTCAGTATGTTT
GCACCGAGGTCGCCTGCGCCAGTACCCACATCGGACAACATCGTCGATAGTTTTAAGGCAACACAGTGTGATCTT
ATATTTACTGTCCCCTCTATGATTGAGGTTTGGTCACATAATCCAGACTATATCAAGCTGTTTGCTACTCGCATG
GGAATTGCCTTCGGAGGCGGACCGCTCAATAAAGAGGTTGGTGACTCGCTCACTGCTCGGGGTGTTACCCTGTTC
ACTTTATATGGCGCTACCGAGACCGGTGCAGCATGTATGGTGTTTGTTGCGAATGTCGGTGGTAGCTGGGATTAT
TTCAGATTCCCACCGCATATGACTGCAAAGATGGTGCCATCGGGCGAAGGAACGTTCGAGCTTGTCATCGTGCCA
GGCTACTGGAAGGTTATCGGACGCACCGATGACCAAATTATGCATAGCACTGGAGAAAAGACGAACCCAGGACCT
CTCGAGAGCATCATGAACACGGACCGTCATGTCAGAGCATCCGTGATGTTTGGGCGTGGGCGATTTCAGGTTGGG
ATCCTTATCGAGCCTCAACCCGGATTCGTACTCGACCCATCAGACGAAGGTTCATTGACAAGCTTCAGGAACAAG
ATCTGGCCAACTGTCGAGAAGATGAACACATATGCGCCGCAGCATTCAAGACTATTCAAAGAGATGATATTAGTC
GCGAACCCATCCAAGCCGTTCTTGTACACTTCTAAGAACACTGTCCGCCGGGGCGCTGTCATCATGGAATATGAA
GACGACATAGATGCGCTGTACGACGCGGTTGATTTAAGCGCACAAACCTCCGTGACCTCTCCACATGAGTGGAGT
CTTACCACCGCAATTGACTATGTCCGTCTTGTTGTGCACAAAGTTATAGCACATTCTGTGATGGATGATGACGAC
ATTTTCCAGCACGGATGTGACAGCCTGCAGGCCACGTACATTCGCAACATTATTCTCGGTGCCCTCCGTGACACA
ACAAAGGTGAACACACGCAAGATCAGCGACAGCTTCGTCTACGACCATCCGACCATTTCTAGACTGGCTGCATTT
GTCTCTTCCGTCGCCCTGGGAACGCACGACGCAGCGGCAATGGGAGTTAACCCATCTGCTCGCATTCTGGCCATG
CGAGCTATGCTTGCCAAATGTTCCGCTGATTTCCCAGCGCGGCCTCACACACTGCTTCCATCACAGCCTAAGCGA
GATGCGGTCTTCGTGACAGGGACAACGGGTAGTATAGGGTGCCATCTGCTTGCTTTGCTCGTGGCCGACCCAAAG
GTCTGGCGGGTGTATGCGTTCAACAGGCCAGCCAAGACGCAGACGCATTTGCGCGAGAGACAGAAGTCGGCCTTG
GTCGAACGTGGACTCGACGCAAGCATAGCGGATTCGGAGAAAGTGGTGCTTCTGGAGGGAAGCCTGACAGCGGAG
AATTGGGGCGTTGGAAAGAACGCGTACGAAGAGTTGCATAGATCAGTCACGCATATCATCCACAATGCATGGCGT
GTCGACTTCGTAATCAAACTGGAGTCATTCGAGGATAGCATCGCAGACTCGCCCTGCGATGTGAAATTCGCAGAA
GGGCCGAGTGAGCCCGATCTCGCAGTCGGCACAGGATACGCAGAGTCCAAATGGGTCTCCGAGCAGATCCTCTAT
GCAGCAGCATACAAGGCTTCTCTCAACGCGCTGGTCGTCCGCGTGGGACAGGTTTGCGGTGGCCTCAATGGCGCG
TGGAACGCGCACGAGTGGTTCCCTACCCTCGTGCAGAGCACACTGGAGCTGGGATGCTTCCCAGACGACGATAAG
GGCGTGAACTGGATCCCGCTCGAGATTGCGGCAGGGGCGATTGCCGACTTCCGCCACGCTGCGAATCCAACACAC
ACCGTACACCTCGTGCACCCACACCCGGTCTCGTGGCACTCTCTCGCGACTGTCGTCTCATCTGAGCTTAGCGTC
CCACTCGTGGCGTACTCAGCATGGTTGGCCAAGCTGGAACATACGACGCAGACACACGAGCACACCGGGCATGGA
AGTACTCAGATTGCGAGAAGCCTGCGTGCCCTGCAGCTTCTGCCGTTCTTTCGGGGGATAACTGAGAAATTGGGC
GCCACGCGAATGTCAATGGGTCTACCAGACCTTGAGGTCAAGCAGGCTATGGCGGGGTCGCCGACGCTGAGAGCT
CCTGACCTTCGTCAGCTTGGAGGGGAGGATGTCGAAAGGTGGTTGGCGTACTGGAGGACATGGCGTCTTCCGGAA
GGCACCGAAGGCGTTGCACCGATCTCGGGGGTAGACCTACTTAGTGATGCGAAGGAGATCCTCTGCACATTGGCG
GGCCGAACCCGCTCAACACTCTGCTCATCTGCGCGGAGTATGTCCGCGGCGCGCGGCGGTGAAGAATGGTTCGTC
GGCTTCGTCCAGAAGTTCGTGGCGCAACGCCGCGGAGCACGGAAGACAAAGGCGAGGCTAGGACTGCCGCCCTTG
CGAGTTCTGGGGCTTAGGGCAGAAGCTGGCAACCACAGCAATGGCAGTGCAGCAGCCTCGTGCACATATATGCAA
ATCGAAGAGAAGCGCACGCTGAACAAAGCGACAGCGGAGGCTAATCTGGGCTATTCATCCGGGCCGCAAGGTAAT
GATCCGTTCTCGGCACGACACGCGACTTGTGTTCGGTTCCGGCACGTCAACTACCAAGATGAGAGGGGCCAGGAC
GACGGAGGCAGCCACTTCCAGCATCCCGCTGCAGATAGCACGCAACAGAAAGCACAGAAGAGCATGCTCAACTCC
CGCCTGCCCCGCGGATCCCAGCCCGACTATGATGGCGAGCTTCCCCGCACGAACGGTTTGCACCAGAACAAGCCT
CCCTTCACCCGCCTCACCCGGCGACATTTCAGATTCGCCGTCATCGCGCTCCTCGTGATCGCTGCTGTCCCCCTC
GTCCTCCGCCTGCACGCCCCGCTCCGCCGGCGTTTTGCGGGGCCGGCAGAGCCCATGGGCGCGGACGCGCAGGAG
GACACTTCTGAGAAGCCGCCGCTCTACGGCGAGTGGCATCAGTACGAGCAGGACATCTCGCGGAGACAGCACTTC
CCCCCGAACGCGAAGTACCTCTTCACGTCGACGCACACCCGAGGCGCGGGATGGGGGAATGCGATGCAAGAGCTG
ATAATGCACTCGTACCTCGCGTACCGCAGCGGACGAACATTTACCTGGTACAACTACACCTGGAATGACGACGGC
TCCGATTATACGCTCTACAACGGCAAGCACATACCTTCACGCATCCCCATGTCGGCGCTCCTTGGCGGTCCAATT
GTGGGCGAGCCATACCACACGGACCCCACCGCGCCGCAGCCCGCGTCGATATCAGAGCAGTACTACCGCGAGATC
TGCACGGAGAGTGAACGCCGCAAGATCGACAACGGAGACATCGTCGCGCAGCTCGGCGGTGGGTACTCGGCGACA
GCGCTGCTCGACAAGTGGGTCGAGGTTATGGCCGAGACGGACGCGCGCTGCGTCGAGATCCCGTACGAGAGTGTT
CCGCTTTTCGACTTCTGGATCATGGGCGACGCGGGGCGCCTGCTCAACGCCTGGGACGGGCTCGCCGCATCGCCG
GTGCTGCGCGAGTTCCGCTGGTCGCCCCTCGTCGAGCTCGCGTTCGACACGAACCGCGAGACGATCTCGCCGGCC
CAGATCTCCGCGCCGTACCTGACGTCGCTGCCCGCGGACCTGGGGCCGCGCGCAAACCCCAGCGCAACGCGCTAC
GCGCCGCTGCCCGGGCTGCTCGCGATGCACATCCGCCGCGGGGACTTTGCGGGGCACTGCGAGCACCTCGGGCGG
TGGTCGTCGCCGTGGGTGGGGTTCAACTCGTTCGCGGCACTGCCGGACGTGCTCGACACGGGGCGGCTGCCGAGC
GACGAGGCGGCGCGCATCGAGCTGTACCGGACGCACTGCTTCCCGAACATCGCGGAGATCGTCGTGCGGGCGGAG
GCGCTGCGCGTGGCGGAGGCGGAGGGCGGGCGCGGGGAGCTGCGCGACGTGTACGTGATGACGAACGGGCCGGTG
GAGTGGGTGGCGGAGCTGGAGGCGGCGCTGAAGGAGACGGGGCACTGGCGGCACGTGGCGAGCAGCCGCGACCTG
CTGGTGAACCAGGAGCAGAAGTACGTGAAGCAGGCCGTGGACATGCTGATCGGGCAACGCGCGCAGGTGTTCGTG
GGTAATGGGTGGTCGAGCTTGACGGGGCTCGTCAGCATGCTGCGCATGGGAAATGGGATCAACCCCAAGCAGACA
CGGATGTTGTGA
Transcript >RhoplFPRL280|465_1
ATGCAGCAAATGACTGTATTGGGCACTATCCTCTGTGCAGACATGGAAGATACTTCAAGGACAGATGATTACAGA
CGTCTTTACTTCCCCTTGGGTTGTGCCAAATGGTGGTATCCACCGGCAGCATGCAGTTTCGGATACTCGATACCT
CTTGCTGCTCCTAACGGCACGTTTCACAAACATGATAGAAACAATACATTTCAGGCGCATGATGAAATTCATGGA
CAGTCGTCCACTACGTTCCGACCACCCCCGCTCGATGGTTTGCTGCTCATACCAGAGCTCTGGGAATGGCATGCG
CGGTACTCTCCAGATCATCCGCTTTTCGTCTTTGCAGATGAGGGTGGCATTGTCCGTCGACTATGCTGGCCCGAG
GTGGTGCGAGCCATCCACACCGGTGCTAAGATTATCAGAAATCGTACGAATTGGAAGGCCGGCACAGCTGAATCT
CCTACTGTGGCTATTCTGGCAAACTCAGACTCAATCTCATACGCGACAACCCTAATGGCTATTATTCGCGCTGAG
TACACAGGCTTCCTCATTTCTACGCGTAATTCTCCTGCGGCGATCGCACATCTGCTGAACATTGTCGGAGTCCAA
CATCTCCTTATCGGACGTGAACCGTTGGTCTGCGAGCTTGCCACCAAGTCGTTGAATATACTACGGGCGAGATAT
CCATGCGCGCACGTGCCTGAGACGTCACTCGCGCTGATTTTCGAAGAGCTCTATCTGCCCAACTCAGAAACCGTT
TCTGCTGATGATGTGCCCTACGAGCGTCAAAAACTCGAAGACCCTATCATTATTTTACACACGTCCGGTTCAACG
GCATTTCCGAAACCGATTACGCTCACACATCGTCGCGCCATTGAGATCATCATTACACCATGCTTCGTGCACGTC
CTGCCCATGTTCCATATCATGGGCATGTTCTTTACAATGTCGGCTGTTTCGTGTGGCTTCATTGTCAGTATGTTT
GCACCGAGGTCGCCTGCGCCAGTACCCACATCGGACAACATCGTCGATAGTTTTAAGGCAACACAGTGTGATCTT
ATATTTACTGTCCCCTCTATGATTGAGGTTTGGTCACATAATCCAGACTATATCAAGCTGTTTGCTACTCGCATG
GGAATTGCCTTCGGAGGCGGACCGCTCAATAAAGAGGTTGGTGACTCGCTCACTGCTCGGGGTGTTACCCTGTTC
ACTTTATATGGCGCTACCGAGACCGGTGCAGCATGTATGGTGTTTGTTGCGAATGTCGGTGGTAGCTGGGATTAT
TTCAGATTCCCACCGCATATGACTGCAAAGATGGTGCCATCGGGCGAAGGAACGTTCGAGCTTGTCATCGTGCCA
GGCTACTGGAAGGTTATCGGACGCACCGATGACCAAATTATGCATAGCACTGGAGAAAAGACGAACCCAGGACCT
CTCGAGAGCATCATGAACACGGACCGTCATGTCAGAGCATCCGTGATGTTTGGGCGTGGGCGATTTCAGGTTGGG
ATCCTTATCGAGCCTCAACCCGGATTCGTACTCGACCCATCAGACGAAGGTTCATTGACAAGCTTCAGGAACAAG
ATCTGGCCAACTGTCGAGAAGATGAACACATATGCGCCGCAGCATTCAAGACTATTCAAAGAGATGATATTAGTC
GCGAACCCATCCAAGCCGTTCTTGTACACTTCTAAGAACACTGTCCGCCGGGGCGCTGTCATCATGGAATATGAA
GACGACATAGATGCGCTGTACGACGCGGTTGATTTAAGCGCACAAACCTCCGTGACCTCTCCACATGAGTGGAGT
CTTACCACCGCAATTGACTATGTCCGTCTTGTTGTGCACAAAGTTATAGCACATTCTGTGATGGATGATGACGAC
ATTTTCCAGCACGGATGTGACAGCCTGCAGGCCACGTACATTCGCAACATTATTCTCGGTGCCCTCCGTGACACA
ACAAAGGTGAACACACGCAAGATCAGCGACAGCTTCGTCTACGACCATCCGACCATTTCTAGACTGGCTGCATTT
GTCTCTTCCGTCGCCCTGGGAACGCACGACGCAGCGGCAATGGGAGTTAACCCATCTGCTCGCATTCTGGCCATG
CGAGCTATGCTTGCCAAATGTTCCGCTGATTTCCCAGCGCGGCCTCACACACTGCTTCCATCACAGCCTAAGCGA
GATGCGGTCTTCGTGACAGGGACAACGGGTAGTATAGGGTGCCATCTGCTTGCTTTGCTCGTGGCCGACCCAAAG
GTCTGGCGGGTGTATGCGTTCAACAGGCCAGCCAAGACGCAGACGCATTTGCGCGAGAGACAGAAGTCGGCCTTG
GTCGAACGTGGACTCGACGCAAGCATAGCGGATTCGGAGAAAGTGGTGCTTCTGGAGGGAAGCCTGACAGCGGAG
AATTGGGGCGTTGGAAAGAACGCGTACGAAGAGTTGCATAGATCAGTCACGCATATCATCCACAATGCATGGCGT
GTCGACTTCGTAATCAAACTGGAGTCATTCGAGGATAGCATCGCAGACTCGCCCTGCGATGTGAAATTCGCAGAA
GGGCCGAGTGAGCCCGATCTCGCAGTCGGCACAGGATACGCAGAGTCCAAATGGGTCTCCGAGCAGATCCTCTAT
GCAGCAGCATACAAGGCTTCTCTCAACGCGCTGGTCGTCCGCGTGGGACAGGTTTGCGGTGGCCTCAATGGCGCG
TGGAACGCGCACGAGTGGTTCCCTACCCTCGTGCAGAGCACACTGGAGCTGGGATGCTTCCCAGACGACGATAAG
GGCGTGAACTGGATCCCGCTCGAGATTGCGGCAGGGGCGATTGCCGACTTCCGCCACGCTGCGAATCCAACACAC
ACCGTACACCTCGTGCACCCACACCCGGTCTCGTGGCACTCTCTCGCGACTGTCGTCTCATCTGAGCTTAGCGTC
CCACTCGTGGCGTACTCAGCATGGTTGGCCAAGCTGGAACATACGACGCAGACACACGAGCACACCGGGCATGGA
AGTACTCAGATTGCGAGAAGCCTGCGTGCCCTGCAGCTTCTGCCGTTCTTTCGGGGGATAACTGAGAAATTGGGC
GCCACGCGAATGTCAATGGGTCTACCAGACCTTGAGGTCAAGCAGGCTATGGCGGGGTCGCCGACGCTGAGAGCT
CCTGACCTTCGTCAGCTTGGAGGGGAGGATGTCGAAAGGTGGTTGGCGTACTGGAGGACATGGCGTCTTCCGGAA
GGCACCGAAGGCGTTGCACCGATCTCGGGGGTAGACCTACTTAGTGATGCGAAGGAGATCCTCTGCACATTGGCG
GGCCGAACCCGCTCAACACTCTGCTCATCTGCGCGGAGTATGTCCGCGGCGCGCGGCGGTGAAGAATGGTTCGTC
GGCTTCGTCCAGAAGTTCGTGGCGCAACGCCGCGGAGCACGGAAGACAAAGGCGAGGCTAGGACTGCCGCCCTTG
CGAGTTCTGGGGCTTAGGGCAGAAGCTGGCAACCACAGCAATGGCAGTGCAGCAGCCTCGTGCACATATATGCAA
ATCGAAGAGAAGCGCACGCTGAACAAAGCGACAGCGGAGGCTAATCTGGGCTATTCATCCGGGCCGCAAGGTAAT
GATCCGTTCTCGGCACGACACGCGACTTGTGTTCGGTTCCGGCACGTCAACTACCAAGATGAGAGGGGCCAGGAC
GACGGAGGCAGCCACTTCCAGCATCCCGCTGCAGATAGCACGCAACAGAAAGCACAGAAGAGCATGCTCAACTCC
CGCCTGCCCCGCGGATCCCAGCCCGACTATGATGGCGAGCTTCCCCGCACGAACGGTTTGCACCAGAACAAGCCT
CCCTTCACCCGCCTCACCCGGCGACATTTCAGATTCGCCGTCATCGCGCTCCTCGTGATCGCTGCTGTCCCCCTC
GTCCTCCGCCTGCACGCCCCGCTCCGCCGGCGTTTTGCGGGGCCGGCAGAGCCCATGGGCGCGGACGCGCAGGAG
GACACTTCTGAGAAGCCGCCGCTCTACGGCGAGTGGCATCAGTACGAGCAGGACATCTCGCGGAGACAGCACTTC
CCCCCGAACGCGAAGTACCTCTTCACGTCGACGCACACCCGAGGCGCGGGATGGGGGAATGCGATGCAAGAGCTG
ATAATGCACTCGTACCTCGCGTACCGCAGCGGACGAACATTTACCTGGTACAACTACACCTGGAATGACGACGGC
TCCGATTATACGCTCTACAACGGCAAGCACATACCTTCACGCATCCCCATGTCGGCGCTCCTTGGCGGTCCAATT
GTGGGCGAGCCATACCACACGGACCCCACCGCGCCGCAGCCCGCGTCGATATCAGAGCAGTACTACCGCGAGATC
TGCACGGAGAGTGAACGCCGCAAGATCGACAACGGAGACATCGTCGCGCAGCTCGGCGGTGGGTACTCGGCGACA
GCGCTGCTCGACAAGTGGGTCGAGGTTATGGCCGAGACGGACGCGCGCTGCGTCGAGATCCCGTACGAGAGTGTT
CCGCTTTTCGACTTCTGGATCATGGGCGACGCGGGGCGCCTGCTCAACGCCTGGGACGGGCTCGCCGCATCGCCG
GTGCTGCGCGAGTTCCGCTGGTCGCCCCTCGTCGAGCTCGCGTTCGACACGAACCGCGAGACGATCTCGCCGGCC
CAGATCTCCGCGCCGTACCTGACGTCGCTGCCCGCGGACCTGGGGCCGCGCGCAAACCCCAGCGCAACGCGCTAC
GCGCCGCTGCCCGGGCTGCTCGCGATGCACATCCGCCGCGGGGACTTTGCGGGGCACTGCGAGCACCTCGGGCGG
TGGTCGTCGCCGTGGGTGGGGTTCAACTCGTTCGCGGCACTGCCGGACGTGCTCGACACGGGGCGGCTGCCGAGC
GACGAGGCGGCGCGCATCGAGCTGTACCGGACGCACTGCTTCCCGAACATCGCGGAGATCGTCGTGCGGGCGGAG
GCGCTGCGCGTGGCGGAGGCGGAGGGCGGGCGCGGGGAGCTGCGCGACGTGTACGTGATGACGAACGGGCCGGTG
GAGTGGGTGGCGGAGCTGGAGGCGGCGCTGAAGGAGACGGGGCACTGGCGGCACGTGGCGAGCAGCCGCGACCTG
CTGGTGAACCAGGAGCAGAAGTACGTGAAGCAGGCCGTGGACATGCTGATCGGGCAACGCGCGCAGGTGTTCGTG
GGTAATGGGTGGTCGAGCTTGACGGGGCTCGTCAGCATGCTGCGCATGGGAAATGGGATCAACCCCAAGCAGACA
CGGATGTTGTGA
Gene >RhoplFPRL280|465_1
ATGCAGCAAATGACTGTATTGGGCACTATCCTCTGTGGTATGCAAATCAAATTACTTGTGCTAGGCACTGCGAAT
GAAGCGAAATTCTTCGGTCCCTGACTCAGGACAAATATGGAGTCCAATGCAGTTGCGGTTACGCCGCATTGGTCA
TAGAAATGAATGTGTCGCGACCCATTCCCTGTACAGTGGGTGCGTACTACGTGACTGTCGGCTTGGGGGGTCTTC
CGACCACTCTGACAGGGCACATCAAACCCACTGCTACACCATCGTGTCTCATGATCTTGCGGCGAGTCGCTGGGA
GAAGACTGTCCCGGGAAGTCGCTGTCAATCCGCTGTTGAGCGCAGTTACATATTGCTAATTGCTACTTCAACATT
TTTGGCAATATATTGGTGTCTATAGCGCTATCATAAGACTTCCAAATCAGGAGGAGCACAATGACGGTCTCATTC
AGTCCTCATGCTCCCCAAAGAACACATTCAAGCTGAGGTTGTCCCTCCGCCGCTTCCCAACGCGTATAGTTTGGT
CATGCAAATGGCAGCATAATGACATCTGTTTTGCGGTGAGCAGTCCCATTTGAATAATAAATGCTCCAAATTATC
GAAGCTGTCATCAGACATGGAAGATACTTCAAGGACAGATGATTACAGACGTCTTTACTTCCCCTTGGGTTGTGC
CAAATGGTGGTATCCACCGGCAGCATGCAGTTTCGGATACTCGATACCTCTTGCTGCTCCTAACGGCACGTTTCA
CAAACATGATAGAAACAATACATTTCAGGCGCATGATGAAGTGAGGCCATATAAGATATCCCGCCAGTTGCTTTC
CCCTACCCGTATTCTTCTACCTGAAGGTTCTGAGATGTCAACGCCCTCTAGGTTTCTTCACGCTTCCATCCCTCA
GATTCATGGACAGTCGTCCACTACGTTCCGACCACCCCCGCTCGATGGTTTGCTGCTCATACCAGAGCTCTGGGA
ATGGCATGCGCGGTACTCTCCAGATCATCCGCTTTTCGTCTTTGCAGATGAGGGTGGCATTGTCCGTCGACTATG
CTGGCCCGAGGTGGTGCGAGCCATCCACACCGGTGCTAAGATTATCAGAAATCGTACGAATTGGAAGGCCGGCAC
AGCTGAATCTCCTACTGTGGCTATTCTGGCAAACTCAGGTGATATCCGTCTCTGTGAACTACACAATTGCCATTG
ATACTGCGGCCTTATTCAGACTCAATCTCATACGCGACAACCCTAATGGCTATTATTCGCGCTGAGTACACAGGC
TTCCTCATTTCTACGCGTAATTCTCCTGCGGCGATCGCACATCTGCTGAACATTGTCGGAGTCCAACATCTCCTT
ATCGGACGTGAACCGTTGGTCTGCGAGCTTGCCACCAAGTCGTTGAATATACTACGGGCGAGATATCCATGCGCG
CACGTGCCTGAGACGTCACTCGCGCTGATTTTCGAAGAGCTCTATCTGCCCAACTCAGAAACCGTTTCTGCTGAT
GATGTGCCCTACGAGCGTCAAAAACTCGAAGACCCTATCATTATTTTACACACGTCCGGTTTGCACCTTTGATTT
GATTTGCCTATGACCGTAACCGAATGCTTATGTCCCAGGTTCAACGGCATTTCCGAAACCGATTACGCTCACACA
TCGTCGCGCCATTGAGATCATCATTACACCATGCTTCGGTGAGCGTGATCTTGCAGGTATTGTAGTCTCAATGCA
CGTCCTGCCCATGTTCCATATCATGGGCATGTTCTTTACAATGTCGGCTGTATGTACAGTATTATTCATGTCCAT
CAGATATGATATCCAGCGCTAACAGTCAGTGAAAAATAGGTTTCGTGTGGCTTCATTGTCAGTATGTTTGCACCG
AGGTCGCCTGCGCCAGTACCCACATCGGACAACATCGTCGATAGTTTTAAGGCAACACAGTGTGATCTTATATTT
ACTGTCCCCTCTATGATTGAGGTCCGTACAGAGTATGATTTTTCTGAAGTGATTGCTCATTGCTATTGATAGGTT
TGGTCACATAATCCAGACTATATCAAGCTGTTTGCTACTCGCATGGGAATTGTGAGCCTCTTCGCTGTCGTGAAT
GTTGTGGATGATGATGGAGCTCGTTCAGGCCTTCGGAGGCGGACCGCTCAATAAAGAGGTTGGTGACTCGCTCAC
TGCTCGGGGTGTTACCCTGTTCACTTTATATGGCGCGTGCGTGCTTTAACTACCTTTGCGTGTCCCTGTGCATCT
TTACGAGAATGACCTTCAGTACCGAGACCGGTGCAGCATGTATGGTGTTTGTTGGTATGCCTTCCTCATACTTTT
AAAGGGTATACATACAAACCTCTTGCAGCGAATGTCGGTGGTAGCTGGGATTATTTCAGATTCCCACCGCATATG
ACTGCAAAGATGGTGCCATCGGGCGAAGGAACGTTCGAGCTTGTCATCGTGGTATGTCCCAGTTTTGGATATGCG
CGTCGTTAAACACCGACGATGGGATCACACTATCACACCAATCATTGCAGGCGAATGAATACGGATGTCCTAGTG
TCGTGAATACCACGATCGACGGGCTGGATGCATATGCTACTTCTGATCTTCTTATCGAGCACCCGACAAAGCCAG
GCTACTGGAAGGTTATCGGACGCACCGATGACCAAATTATGCATAGCACTGGAGAAAAGGTAAAGATGTGCTGAT
CCCCACTCTTATATATTGTTGTGACGAAATCTTCCTTTAGACGAACCCAGGACCTCTCGGTGCGCACACACATAG
ACATCGCAGGAAATACAGGCATATATTTGGTTTGTAGAGAGCATCATGAACACGGACCGTCATGTCAGAGCATCC
GTGATGTTTGGGCGTGGGCGATTTCAGGTTGGGATCCTTATCGAGCCTCAACCCGGATTCGTACTCGACCCATCA
GACGAAGGTTCATTGACAAGCTTCAGGAACAAGATCTGGTAAAGTCTATATGCATATGGCGATGGCAATGAATAC
TGAGGAACTTGAGTCAGGCCAACTGTCGAGAAGATGAACACATATGCGCCGCAGCATTCAAGACTATTCAAAGAG
GTCAGATCATAGCTCTGCTTCATACGGCAAGAAGTGGTCGCTAAGTGTTCGCCTATAGATGATATTAGTCGCGAA
CCCATCCAAGCCGTTCTTGTACACTTCTAAGAACACTGTCCGCCGGGGCGCTGTCATCATGGAATATGAAGACGA
CATAGATGCGCTGTACGACGCGGTTGATTTAAGCGCACAAACCTCCGTGACCTCTCCACATGAGTGGAGTCTTAC
CACCGCAATTGACTATGTCCGTCTTGTTGTGCACAAAGTTATAGCACATTCTGTGATGGATGATGACGACATTTT
CCAGCACGGATGTGACAGGTGTGTCAATGATCCGCACTAGGGCATGCAATTAACGGCTGAATCAATACCAGCCTG
CAGGCCACGTACATTCGCAACATTATTCTCGGTGCCCTCCGTGACACAACAAAGGTGAACACACGCAAGATCAGC
GACAGCTTCGTCTACGACCATCCGACCATTTCTAGACTGGCTGCATTTGTCTCTTCCGTCGCCCTGGGAACGCAC
GACGCAGCGGCAATGGGAGTTAACCCATCTGCTCGCATTCTGGCCATGCGAGCTATGCTTGCCAAATGTTCCGCT
GATTTCCCAGCGCGGCCTCACACACTGCTTCCATCACAGCCTAAGCGAGATGCGGTCTTCGTGACAGGGACAACG
GGTAGTATAGGGTGCCATCTGCTTGCTTTGCTCGTGGCCGACCCAAAGGTCTGGCGGGTGTATGCGTTCAACAGG
CCAGCCAAGACGCAGACGCATTTGCGCGAGAGACAGAAGTCGGCCTTGGTCGAACGTGGACTCGACGCAAGCATA
GCGGATTCGGAGAAAGTGGTGCTTCTGGAGGGAAGCCTGACAGCGGAGAATTGGGGCGTTGGAAAGAACGCGTAC
GAAGAGGTGTGTGTCTTCGATGTCGGGGTTGATTATCCTGAGCACTGATATGTATTTGTGGACAGTTGCATAGAT
CAGTCACGCATATCATCCACAATGGTGAATATTGTGCATCTTGGAGCCGTGGCGTCGACTAACTGGATTGTGAAC
AGCATGGCGTGTCGACTTCGTAATCAAACTGGAGTCATTCGAGGATAGCATCGCAGGTGTGCGGCGTTTGGTGGA
TTTTGCGCTGACATCTCCATTGCCCCAACCACCACGGGTGCTGTTCGTGAGCTCCATTGGCATCTTCCAAAGTTT
GTCCATAGTCTTGGCATGTTCCATTCGTATGTTGACCGTTCTCTCAGACTCGCCCTGCGATGTGAAATTCGCAGA
AGGGCCGAGTGAGCCCGATCTCGCAGTCGGCACAGGATACGCAGAGTCCAAATGGGTCTCCGAGCAGATCCTCTA
TGCAGCAGCATACAAGGCTTCTCTCAACGCGCTGGTCGTCCGCGTGGGACAGGTTTGCGGTGGCCTCAATGGCGC
GTGGAACGCGCACGAGTGGTTCCCTACCCTCGTGCAGAGCACACTGGAGCTGGGATGCTTCCCAGACGACGATAA
GGTGTGTCTCTGATCTGACTTTATTGTCCGAGACAGTTGACCAGTAGACCTGATAATGTAGGGCGTGAACTGGAT
CCCGCTCGAGATTGCGGCAGGGGCGATTGCCGACTTCCGCCACGCTGCGAATCCAACACACACCGTACACCTCGT
GCACCCACACCCGGTCTCGTGGCACTCTCTCGCGACTGTCGTCTCATCTGAGCTTAGCGTCCCACTCGTGGCGTA
CTCAGCATGGTTGGCCAAGCTGGAACATACGACGCAGACACACGAGCACACCGGGCATGGAAGTACTCAGATTGC
GAGAAGCCTGCGTGCCCTGCAGCTTCTGCCGTTCTTTCGGGGGATAACTGAGAAATTGGGCGCCACGCGAATGTC
AATGGGTCTACCAGACCTTGAGGTCAAGCAGGCTATGGCGGGGTCGCCGACGCTGAGAGCTCCTGACCTTCGTCA
GCTTGGAGGGGAGGATGTCGAAAGGTGGTTGGCGTACTGGAGGACAGTCGGCCTTTTCTAAAATGCATTTTTTGT
CCTTCATCTCGCAATGTATAATGTACCAGAAAGCGATCTGAGAAGCCACTAACAAGACTGCCGATGTATCATTTG
AAGGAATCCAGTGGCTGAGTGAACGACTCTTGGAATGGTCTTCGCAACAAACGAATATTCTTTCGGACCCGTTGA
TAAAGCTTAAAGGTTGTGAAAGATGAGGCTGCAGTGGCGTCTTCCGGAAGGCACCGAAGGCGTTGCACCGATCTC
GGGGGTAGACCTACTTAGTGGTATGTCCGGCTCAGTGTAGCTAATATTGCTGTCACTACGGTTTCAGATAAGATG
CGAAGGAGATCCTCTGCACATTGGCGGGCCGAACCCGCTCAACACTCTGCTCATCTGCGCGGAGTATGTCCGCGG
CGCGCGGCGGTGAAGAATGGTTCGTCGGCTTCGTCCAGAAGTTCGTGGCGCAACGCCGCGGAGCACGGAAGACAA
AGGCGAGGCTAGGACTGCCGCCCTTGCGAGTTCTGGGGCTTAGGGCAGAAGCTGGCAACCACAGCAATGGCAGTG
CAGCAGCCTCGTGCACATATATGCAAATCGAAGAGAAGCGCACGCTGAACAAAGCGACAGTGGTGTCCACGTCTT
TCTCCGGATGCTGCCCCATGAGTTTCTCTCTGCATTGTCACATGCGGAGGCTAATCTGGGCTATTCATCCGGGCC
GCAAGGTAATGATCCGTTCTCGGCACGGTAAGTAAGGACAAGCTGGCGGTGCGCGGAAGAATATAGGATGATGGC
AGGGAAGTCGCCATATCAATGCTGCATGCATAACGATTCGGACCTTTGCGCATGATGATACCACAGACGGACTCA
AAGAAGTCCCCTGGGTCTGCTGGGATCTCGAAAGTCACGGAAGCTTACTAATCAGTTGGCGCGCCCCTCAATGTC
CGGTGCTGTCAGATCATGACACGTTTTTATATAGTGGCTGAAGCGCTGATATCGAGAGGACGCTCACTGCTTATA
GTAACAGAGCGACTGCATCATGTCAGCTTGAGGCGTCCCGGGCGGAAGACCGCCCGTCAAATAGTTCCGCGGGCA
AGAAGGATCGCGAAGTTCTGCAAGAATGAAGCAACTTGAGGTGTGGTCGTCAAGGGAAATCGAGTCCGTAGGGGT
GGCGAATCTGCTCTCAGAGGATGCTGATTTTGTCATCCAAGTCTACCAAGTGATTGTCGCCGGCCGAGTCATGCT
GTACATTGATCAGACACGCGACTTGTGTTCGGTTCCGGCACGTCAACTACCAAGATGAGAGGGGCCAGGACGACG
GAGGCAGCGTGGGTTGAGGTCCCACACGGTCAGGCTACATCCGCTCGGTGGGACTCGGAGGTTGTGCTGGCAGAA
ACCTTCCATAAATTGATATAGGCCAACATGAACGGGATTGAGGACGATGGATATTGCTAGCCGAGACGTAGTGCA
AGTACATAGTCCTGCGTGATCACTGATTGAAGCTCGGGAGCTGTCTGCTGGAAACCTTGTGAGATGACAGATTGA
CGGCAAACGCCCGATCACATAAGCGTGGCCATCAAAGCAGCCAAGTTGGGCAGTTTGTATTGCATCCTCTTCTCT
GAGCGCGTACGCCCTTCCATGCCATACGAGCATGTTTGATATGTACGTAAGTCCAGTCTATGAATACACTACCAC
GTTGAATGGGAATATCGCGACCATCTGCACCTCGCTGGTTGGTGCATATATCTGCTCCCCGGTCAGGACTACCCG
CGACGCGACTCAGCATCTGTCTTTGGCCGTATCTATATGCACAGCTATACACCAATATAGCACTTCCAGCATCCC
GCTGCAGATAGGTATGTATTTCATTTTCTCTCAGGCGTCCCGAAGAAATCCCTGATCACGATGCATTGACGGGTC
ATTACATGGAGTAGCGTATAAATTCGCGCCCCGCGCCCGCGCCTGTACTACTGCGCCTGCCAGTGTCCCCCTCAT
GCCCTCGAGCCGCTCATAGCACGCAACAGAAAGCACAGAAGAGCATGCTCAACTCCCGCCTGCCCCGCGGATCCC
AGCCCGACTATGATGGCGAGCTTCCCCGCACGAACGGTTTGCACCAGAACAAGCCTCCCTTCACCCGCCTCACCC
GGCGACATTTCAGATTCGCCGTCATCGCGCTCCTCGTGATCGCTGCTGTCCCCCTCGTCCTCCGCCTGCACGCCC
CGCTCCGCCGGCGTTTTGCGGGGCCGGCAGAGCCCATGGGCGCGGACGCGCAGGAGGACACTTCTGAGAAGCCGC
CGCTCTACGGCGAGTGGCATCAGTACGAGCAGGACATCTCGCGGAGACAGCACTTCCCCCCGAACGCGAAGTACC
TCTTCACGTCGACGCACACCCGAGGTATGTGATGTTTGTCCCCTTCCTGGCCTGCCTCGATCAGGTCCCGCGTGA
TCTCGAAGGTGAAGCGAGGAAGAGGGCCGGAGCCCTTCCGAGCGCAACCTACTCATCGCGTGAGCAGCGATGTGC
CGGTTAACGACCGACTGCGCGACTGGCGTCCAGTCGTCCGGACGGTGGACCCAGGAGGTTGTGACGATGCAGGCC
GTGAACGACTGTGCATTCTCCGACTGCCTTTGTGGGAGGTGTGAGAGAGAATGCCGCGACGTTCGGTCGTCGATC
GATCACAGCCGAGGGCGCACATACTATGGCGTGTCATGCTGGGCACACGACCTGATCATCTCGTGGGAGCGTACC
CAGACGCGTCACTCGGTCTCGCAGGCCGAGCCGTACTTGGTACCCGGTTCCCCTTGGGGCTTGGGGGCCGCGATC
ACCAAGGCCGTGTCACCCGCAGTGGCCTACCGTGTACTAACGGATGTCTGTCTTATCCAGGCGCGGGATGGGGGA
ATGCGATGCAAGAGCTGATAATGCACTCGTACCTCGCGTACCGCAGCGGACGAACGTAGGTCTAATTTGGCTGCT
TTTGTAGACTGACCCAATGAGCGTTTTGGACGCAGATTTACCTGGTACAACTACACCTGGAATGACGACGGCTCC
GATTATACGCTCTACAACGGCAAGCACATACCTTCACGCATCCCCATGTCGGCGCTCCTTGGCGGTGAGTCCGCT
TCCCCATTTTGTCTCATCACTCATCTCTGCAGACCTTACCTGACCCCACCCGTCATCCATCAGGTCCAATTGTGG
GCGAGCCATACCACACGGACCCCACCGCGCCGCAGCCCGCGTCGATATCAGAGCAGTACTACCGCGAGATCTGCA
CGGAGAGTGAACGCCGCAAGATCGACAACGGAGACATCGTCGCGCAGCTCGGCGGTGGGTACTCGGCGACAGCGC
TGCTCGACAAGTGGGTCGAGGTTATGGCCGAGACGGACGCGCGCTGCGTCGAGATCCCGTACGAGAGTGTTCCGC
TTTTCGACTTCTGGTGCGTATCCGCATGTGTTCACATGGCCGCCACCCATGTGCCCTAGCATGCTGACGCACATA
CACGCCAACAGGATCATGGGCGACGCGGGGCGCCTGCTCAACGCCTGGGACGGGCTCGCCGCATCGCCGGTGCTG
CGCGAGTTCCGCTGGTCGCCCCTCGTCGAGCTCGCGTTCGACACGAACCGCGAGACGATCTCGCCGGCCCAGATC
TCCGCGCCGTACCTGACGTCGCTGCCCGCGGACCTGGGGCCGCGCGCAAACCCCAGCGCAACGCGCTACGCGCCG
CTGCCCGGGCTGCTCGCGATGCACATCCGCCGCGGGGACTTTGCGGGGCACTGCGAGCACCTCGGGCGGTGGTCG
TCGCCGTGGGTGGGGTTCAACTCGTTCGCGGCACTGCCGGACGTGCTCGACACGGGGCGGCTGCCGAGCGACGAG
GCGGCGCGCATCGAGCTGTACCGGACGCACTGCTTCCCGAACATCGCGGAGATCGTCGTGCGGGCGGAGGCGCTG
CGCGTGGCGGAGGCGGAGGGCGGGCGCGGGGAGCTGCGCGACGTGTACGTGATGACGAACGGGCCGGTGGAGTGG
GTGGCGGAGCTGGAGGCGGCGCTGAAGGAGACGGGGCACTGGCGGCACGTGGCGAGCAGCCGCGACCTGCTGGTG
AACCAGGAGCAGAAGTACGTGAAGCAGGCCGTGGACATGCTGATCGGGCAACGCGCGCAGGTGTTCGTGGGTAAT
GGGGTGAGTGTCGTTTCTTGCGTTCTAGTGACATGTACTCATCGAGATTGGACGGACACAGTGGTCGAGCTTGAC
GGGGCTCGTCAGCATGCTGCGCATGGGAAATGGGATCAACCCCAAGCAGACACGGATGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail