Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|42_18
Gene name
LocationNODE_42:36320..38630
Strand+
Gene length (bp)2310
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05978 UNC-93 Ion channel regulatory protein UNC-93 1.0E-14 85 424
PF07690 MFS_1 Major Facilitator Superfamily 2.4E-11 74 425

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 83 100 17
3 104 126 22
4 133 155 22
5 170 192 22
6 199 221 22
7 262 279 17
8 299 316 17
9 326 348 22
10 378 400 22
11 438 460 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup527
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|012150
Agaricus bisporus var bisporus H39 AgabiH39|012160
Agaricus bisporus var bisporus H39 AgabiH39|087950
Agaricus bisporus var bisporus H97 AgabiH97|012150
Agaricus bisporus var bisporus H97 AgabiH97|012160
Agaricus bisporus var bisporus H97 AgabiH97|087950
Rhodonia placenta FPRL280 RhoplFPRL280|42_18 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|42_18
MSMSDYSLEKDNASGSGIDVESPAAAAPADFQRPTGLKGFYYNPVVQVFMLGFVCFMGPGLFNALNGLGGGGQLS
TTTSANANVALYATFAFTAFFAGSINNVLGPRLTLLLGSSGYALYIGSYLTVNIHPKAGAFVIAAGAVLGICAGL
LWTAQGCLMLAYPIESQKGAFIGIFWTIFNLGGVVGASVSLGQNFHSTVFLVGNGTYIGFLVLTCIGVLIPMLMA
NPDKMRRSDGTKVMTLRHPSWKTEFYGLWITLRTDPTIILLFPMFFASNWFYTWQFNDYNAALFTIRARALNNLV
YWLAQIVGSVSIGFLLDQRALTRRFRAFAGWTALFLMVFVVHIWAYFYQKNYTRATIALEAQDDDKIDIYDKPYV
GRVFLYIICGMLDAMWQTTAYWIMGAMSNDPAKLANLTGFYKSLQSAGAAGIWRGDAVSLPYMNIFVSTWALLVG
GLVFALPMIFMRVRDHTEPSDEIDNILANLETPAAPNAGPEPKTNST*
Coding >RhoplFPRL280|42_18
ATGTCGATGTCCGACTACTCCCTCGAGAAGGACAATGCCAGCGGGAGCGGCATCGACGTCGAGTCTCCCGCCGCC
GCCGCCCCCGCGGACTTCCAGCGCCCGACCGGGCTCAAGGGCTTCTACTACAACCCGGTCGTGCAGGTGTTCATG
CTCGGCTTCGTATGCTTCATGGGCCCCGGGCTCTTCAACGCGCTGAACGGCCTCGGCGGCGGCGGGCAGCTGAGC
ACGACGACGAGCGCGAACGCGAACGTGGCGCTGTATGCGACCTTTGCGTTCACCGCGTTCTTTGCCGGCTCGATC
AACAATGTGCTCGGTCCCCGCCTCACCCTCCTCCTCGGCAGCAGCGGCTACGCCCTCTACATCGGCTCATACCTA
ACCGTCAATATCCACCCGAAGGCGGGTGCCTTCGTCATCGCTGCAGGTGCCGTCCTGGGCATCTGCGCCGGGCTG
CTGTGGACGGCCCAGGGCTGCCTCATGCTGGCGTATCCCATCGAGAGCCAGAAGGGCGCCTTCATCGGCATCTTC
TGGACCATCTTCAATCTCGGCGGCGTCGTCGGCGCGTCCGTCTCCCTCGGCCAGAATTTCCACTCAACTGTGTTC
CTAGTCGGGAACGGCACCTACATCGGTTTCCTCGTCCTCACCTGCATTGGCGTGCTTATCCCAATGCTGATGGCT
AACCCCGACAAGATGCGCCGGTCAGACGGTACCAAGGTCATGACGCTCCGCCACCCCTCCTGGAAGACCGAGTTC
TACGGCCTCTGGATCACCCTTCGCACGGACCCCACCATCATTCTCTTGTTCCCCATGTTCTTCGCCAGCAACTGG
TTCTACACCTGGCAATTCAACGACTACAACGCCGCGCTGTTCACGATCCGTGCGCGCGCGCTCAACAACCTCGTG
TACTGGCTGGCGCAGATCGTGGGCTCCGTCAGCATCGGGTTCCTCCTGGACCAGAGGGCGCTGACCCGCCGCTTC
CGCGCATTCGCGGGGTGGACCGCCCTCTTCCTCATGGTCTTCGTCGTCCACATCTGGGCGTACTTCTACCAAAAG
AACTACACCCGCGCTACCATCGCGCTGGAGGCACAGGACGACGACAAGATCGACATCTACGACAAGCCGTACGTC
GGCCGGGTGTTCCTGTACATCATCTGCGGCATGCTTGATGCCATGTGGCAAACCACCGCGTACTGGATCATGGGC
GCCATGTCGAACGACCCCGCGAAGCTCGCCAACTTGACTGGATTCTACAAGTCTCTCCAGTCTGCCGGCGCGGCG
GGCATCTGGCGTGGAGATGCCGTCAGTCTCCCGTACATGAACATCTTCGTCTCCACATGGGCGCTCCTCGTCGGA
GGTCTTGTCTTTGCGCTCCCGATGATCTTCATGCGTGTCAGAGACCACACCGAGCCATCAGACGAGATCGACAAC
ATCCTTGCAAACCTGGAAACGCCGGCAGCGCCCAATGCAGGACCTGAACCAAAGACGAACTCGACCTGA
Transcript >RhoplFPRL280|42_18
ATGTCGATGTCCGACTACTCCCTCGAGAAGGACAATGCCAGCGGGAGCGGCATCGACGTCGAGTCTCCCGCCGCC
GCCGCCCCCGCGGACTTCCAGCGCCCGACCGGGCTCAAGGGCTTCTACTACAACCCGGTCGTGCAGGTGTTCATG
CTCGGCTTCGTATGCTTCATGGGCCCCGGGCTCTTCAACGCGCTGAACGGCCTCGGCGGCGGCGGGCAGCTGAGC
ACGACGACGAGCGCGAACGCGAACGTGGCGCTGTATGCGACCTTTGCGTTCACCGCGTTCTTTGCCGGCTCGATC
AACAATGTGCTCGGTCCCCGCCTCACCCTCCTCCTCGGCAGCAGCGGCTACGCCCTCTACATCGGCTCATACCTA
ACCGTCAATATCCACCCGAAGGCGGGTGCCTTCGTCATCGCTGCAGGTGCCGTCCTGGGCATCTGCGCCGGGCTG
CTGTGGACGGCCCAGGGCTGCCTCATGCTGGCGTATCCCATCGAGAGCCAGAAGGGCGCCTTCATCGGCATCTTC
TGGACCATCTTCAATCTCGGCGGCGTCGTCGGCGCGTCCGTCTCCCTCGGCCAGAATTTCCACTCAACTGTGTTC
CTAGTCGGGAACGGCACCTACATCGGTTTCCTCGTCCTCACCTGCATTGGCGTGCTTATCCCAATGCTGATGGCT
AACCCCGACAAGATGCGCCGGTCAGACGGTACCAAGGTCATGACGCTCCGCCACCCCTCCTGGAAGACCGAGTTC
TACGGCCTCTGGATCACCCTTCGCACGGACCCCACCATCATTCTCTTGTTCCCCATGTTCTTCGCCAGCAACTGG
TTCTACACCTGGCAATTCAACGACTACAACGCCGCGCTGTTCACGATCCGTGCGCGCGCGCTCAACAACCTCGTG
TACTGGCTGGCGCAGATCGTGGGCTCCGTCAGCATCGGGTTCCTCCTGGACCAGAGGGCGCTGACCCGCCGCTTC
CGCGCATTCGCGGGGTGGACCGCCCTCTTCCTCATGGTCTTCGTCGTCCACATCTGGGCGTACTTCTACCAAAAG
AACTACACCCGCGCTACCATCGCGCTGGAGGCACAGGACGACGACAAGATCGACATCTACGACAAGCCGTACGTC
GGCCGGGTGTTCCTGTACATCATCTGCGGCATGCTTGATGCCATGTGGCAAACCACCGCGTACTGGATCATGGGC
GCCATGTCGAACGACCCCGCGAAGCTCGCCAACTTGACTGGATTCTACAAGTCTCTCCAGTCTGCCGGCGCGGCG
GGCATCTGGCGTGGAGATGCCGTCAGTCTCCCGTACATGAACATCTTCGTCTCCACATGGGCGCTCCTCGTCGGA
GGTCTTGTCTTTGCGCTCCCGATGATCTTCATGCGTGTCAGAGACCACACCGAGCCATCAGACGAGATCGACAAC
ATCCTTGCAAACCTGGAAACGCCGGCAGCGCCCAATGCAGGACCTGAACCAAAGACGAACTCGACCTGA
Gene >RhoplFPRL280|42_18
ATGTCGATGTCCGACTACTCCCTCGAGAAGGACAATGCCAGCGGGAGCGGCATCGACGTCGAGTCTCCCGCCGCC
GCCGCCCCCGCGGACTTCCAGCGCCCGACCGGGCTCAAGGGCTTCTACTACAACCCGGTCGTGCAGGTGTTCATG
CTCGGCTTCGTATGCTTCATGGGCCCCGGGCTCTTCAACGCGCTGAACGGCCTCGGCGGCGGCGGGCAGCTGAGC
ACGACGACGAGCGCGAACGCGAACGTGGCGCTGTATGCGACCTTTGCGTTCACCGCGTTCTTTGCCGGGTGCGTC
GTGTGCACCGCTGCCTGTCCCCGTGCACTGTATTGACGTGGTGATCGCCCAGCTCGATCAACAATGTGCTCGGTC
CCCGCCTCACCCTCCTCCTCGGCAGCAGCGGCTACGCCCTCTACATCGGCTCATACCTGTGCGTGTGCGCCCTCC
CTGTAGTGTTGTTGGCAGACATCTGCCACTCTGCCAGGTATTTCTGCCCGCTAGGCAACTGCCATGGCAGATGGC
AGACCGGATTTCGGAGCCAGGGGTGGCAATTGCCGTTCTGCCTAGTCTCCTGCGAGCAGAGCAGACAATTCCTTT
AACTTACGCCGGCTCCGGATACCCATGTTGTTCTGGAGGCAGTTGGCAGAAGTCGGCTTCCAGGATTTCTGCCCA
CAACACTACCTCCCCGTATGTTCTGTGCGCAGTCTGAGAGCTTTTCACGCTGTAGAACCGTCAATATCCACCCGA
AGGCGGGTGCCTTCGTCATCGCTGCAGGTGCCGTCCTGGGCATCTGCGCCGGGCTGCTGTGGACGGCCCAGGGCT
GCCTCATGCTGGCGTATCCCATCGAGAGCCAGAAGGGCGCCTTCATCGGCATCTTCTGGACCATCTTCAATCTCG
GCGGCGTCGTCGGCGCGTCCGTCTCCCTCGGCCAGAATTTCCACTCAACTGTGAGCACCTCAACGCGTCTGGCAC
TCACTCGTCGAGCTCACGATGCTTGCTAGGCAAATGCAGGTATGTCACAGAGCGACTGCAGCGCCCCGGGATGCT
GACTGTGCCTCGTGTTCCTAGTCGGGAACGGCACCTACGTAAGTACAGGTTCTGGCAGCCGGGTTCGACAGCAAC
CTCACATCCACACAGATCGGTTTCCTCGTCCTCACCTGCATTGGCGTGCTTATCCCAATGCTGATGGCTAACCCC
GACAAGATGCGCCGGTCAGACGGTACCAAGGTCATGACGCTCCGCCACCCCTCCTGGAAGACCGAGTTCTACGGC
CTCTGGATCACCCTTCGCACGGACCCCACCATCATTCTCTTGTTCCCCATGTTCTTCGCCAGCAACTGGTTCTAC
ACCTGGCGTGGGTATCTTCAGCTGGCTCCCCGTGCTCGTGCGCGACGCTCACCGCATCGTCTACAGAATTCAACG
ACTACAACGCCGCGCTGTTCACGATCCGTGCGCGCGCGCTCAACAACCTCGTGTACTGGCTGGCGCAGATCGTGG
GCTCCGTCAGCATCGGGTTCCTCCTGGACCAGAGGGCGCTGACCCGCCGCTTCCGCGCATTCGCGGGGTGGACCG
CCCTCTTCCTCATGGTCTTCGTCGTCCACATCTGGGCGTACTTCTACCAAAAGTGCGTCATCCGCCGTTTCCGTT
TCCGTTTCCCACAAACTCATGTGTCCCCGTGCGTGCGCCCCTTCAGGAACTACACCCGCGCTACCATCGCGCTGG
AGGCACAGGACGACGACAAGATCGACATCTACGACAAGCCGTACGTCGGCCGGGTGTTCCTGTACATCATCTGCG
GCATGCTTGATGCCATGTGGCAAACCACCGCGTACTGGATCATGGGCGCCATGTCGAACGACCCCGCGAAGCTCG
CCAACTTGACTGGATTCTGTGAGTCGCTTGCGTGCGTGTCAGGGGTCGCGTGCTCATTCCCCTCCCCCCTCAAGA
CAAGTCTCTCCAGTCTGCCGGCGCGGCGGGCATCTGGCGTGGAGATGCCGTCAGTCTCCCGTGAGTGTTTTCATC
AGGCCGTGGCAGAGCAAAAGATGATCGATGGGCTTTCCGGGGCAGGTACATGAACATCTTCGTCTCCACATGGGC
GCTCCTCGTCGGAGGTCTTGTCTTTGCGCTCCCGATGATCTTCATGCGTGTCAGAGACCACACCGAGCCATCAGA
CGAGATCGACAACATCCTGTAAGCCGCTCTATTGTCGAATGCGTACCGGCCGTCGACTTATGTTCTGCTAGTGCA
AACCTGGAAACGCCGGCAGCGCCCAATGCAGGACCTGAACCAAAGACGAACTCGACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail