Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|378_2
Gene name
LocationNODE_378:4729..7415
Strand+
Gene length (bp)2686
Transcript length (bp)2184
Coding sequence length (bp)2184
Protein length (aa) 728

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 7.3E-124 23 537
PF12717 Cnd1 non-SMC mitotic condensation complex subunit 1 2.5E-54 108 271
PF13646 HEAT_2 HEAT repeats 1.1E-09 96 191

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016192 vesicle-mediated transport Yes
GO:0030117 membrane coat Yes
GO:0051641 cellular localization No
GO:0045184 establishment of protein localization No
GO:0051234 establishment of localization No
GO:0071705 nitrogen compound transport No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0015031 protein transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0098796 membrane protein complex No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0032991 protein-containing complex No
GO:0051649 establishment of localization in cell No
GO:0070727 cellular macromolecule localization No
GO:0008150 biological_process No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup4003
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|057780
Agaricus bisporus var bisporus H97 AgabiH97|057780
Rhodonia placenta FPRL280 RhoplFPRL280|378_2 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|378_2
MSGQGSQDAKFFQRGKIQEFRAELQAAESKDKKFTKRKTVLKKIVANITMGNDMSPLFSDVIQCLSIPSLEIKKM
VYLFLVCYGRSKADHISRVIPSFLEDCEDRNPLVRALAIRTMSYIPTSLVVEEIADPLRHALKDKDPYVRKTAAI
CVAKLYTADPRKAERSGFVEMLRDLLLDTNATVVANAVAALSEIGDRQDGVIFRLNLTVANKLLAALGESSEWGQ
IYILDSLLRYVPDRHEDAELMAERIIVQMQHANSAVVLTTIKVLLYLMNYMENRRLMDYICKKMGPPLVTLLSSG
PEVQYVALRNILLIIQRRPQVLKNDVKVFFCKYNDPIYVKLAKLEIMYRLARDENAREVLAELQEYASEVDIDFV
RKAVRSIGRLAIKVSTAADDCIKVLLELIENKVTYVVQEAVIVIKDVFRRYPGKYEGIIPALCENLDALDEPESK
AAMIWIVGQYANRIDNADELMDDLTYTFLDEPTEVQLALLTAAVKLFIYKAQSDTSKALVHKVLKWATEEIDNPD
LRDRGFMYWRLLAINPAVAGEIVLAEKPAITTDADRMDRGALDQLLLHTGTLGSIYHKNPETFIRGATGKALTDS
PALNAASRQVLVPVSRNNMLPPTAIRIPGPGPRDPRKTVPPPPMPPSDGAPVPSAAPVAEASDLLLDTSPSQEGG
DDGDADGDGDGDEDYSQAPASAGGADPYANLDGAFGNYMADEPRPQQSGPLF*
Coding >RhoplFPRL280|378_2
ATGAGTGGGCAGGGCTCCCAAGATGCGAAGTTCTTCCAGCGGGGCAAGATTCAAGAATTCCGCGCAGAACTCCAG
GCCGCGGAGAGCAAGGACAAGAAGTTCACGAAGCGCAAGACGGTGCTCAAGAAGATTGTTGCCAATATCACTATG
GGAAATGATATGTCCCCGTTGTTCAGTGATGTCATACAATGTTTAAGCATCCCATCACTTGAGATTAAGAAGATG
GTATATCTCTTCTTGGTCTGCTATGGGCGATCCAAGGCGGACCATATCTCCCGCGTCATCCCAAGTTTCCTTGAG
GATTGCGAAGACCGGAACCCACTGGTTCGAGCGTTGGCAATCCGGACTATGTCGTACATCCCCACGTCCCTCGTG
GTAGAGGAGATCGCAGACCCACTACGGCATGCCCTCAAAGACAAGGATCCGTATGTGCGGAAGACGGCAGCCATC
TGTGTAGCAAAGCTTTATACAGCTGATCCTCGAAAAGCCGAGAGGAGTGGTTTCGTGGAGATGTTGCGCGACCTT
CTACTAGACACCAATGCGACTGTCGTAGCGAACGCAGTGGCAGCTTTGTCTGAGATTGGCGACCGTCAGGATGGC
GTCATATTCAGACTCAACCTAACTGTTGCCAACAAACTGCTAGCTGCGCTGGGCGAGAGTTCGGAGTGGGGTCAA
ATTTATATTTTGGACTCATTACTGCGTTACGTTCCTGATCGACACGAGGACGCTGAGCTCATGGCAGAGCGGATT
ATCGTACAAATGCAACATGCTAATTCAGCAGTAGTGCTCACCACGATTAAAGTCTTGCTCTACCTCATGAATTAC
ATGGAGAACCGACGACTAATGGACTACATCTGCAAGAAGATGGGTCCGCCATTAGTCACACTACTGTCGTCTGGT
CCCGAGGTACAATATGTAGCGTTGCGCAATATCCTCCTGATCATTCAACGAAGACCACAAGTGCTCAAGAATGAC
GTCAAGGTCTTCTTCTGCAAGTATAATGACCCAATCTACGTCAAGCTGGCGAAGCTTGAAATCATGTACCGTCTT
GCTCGCGATGAGAACGCGCGAGAGGTCCTCGCTGAACTCCAGGAATATGCTTCGGAAGTCGACATCGATTTCGTG
CGGAAGGCCGTCAGATCGATTGGCCGTCTAGCAATCAAAGTGTCGACGGCTGCAGACGACTGCATCAAGGTCTTG
CTGGAGCTGATCGAGAACAAGGTTACCTACGTCGTGCAAGAAGCCGTCATTGTGATCAAGGACGTTTTCCGACGG
TACCCGGGCAAGTACGAGGGCATTATCCCCGCGCTCTGCGAGAATCTTGACGCGCTGGACGAGCCTGAGTCGAAG
GCGGCCATGATCTGGATTGTCGGCCAGTACGCGAACCGGATAGACAATGCGGACGAGCTGATGGATGACCTCACG
TACACGTTCTTGGATGAGCCTACCGAGGTCCAACTGGCTCTCCTGACCGCCGCAGTGAAGCTCTTCATTTACAAG
GCGCAGTCAGACACGAGCAAAGCACTCGTGCACAAGGTTCTCAAGTGGGCGACCGAAGAAATCGACAACCCAGAC
TTGCGGGACCGGGGCTTCATGTATTGGAGACTGCTCGCAATCAACCCGGCCGTCGCTGGGGAGATCGTCCTTGCC
GAAAAGCCTGCCATCACCACCGACGCAGACAGAATGGACCGCGGGGCGCTGGACCAGCTGCTGTTGCACACCGGC
ACGCTGGGTAGCATATATCACAAGAACCCAGAGACCTTCATTCGGGGTGCAACAGGCAAGGCGCTCACGGACAGC
CCAGCCCTGAACGCGGCGTCACGACAGGTCCTGGTGCCCGTCTCACGAAATAACATGCTGCCCCCGACTGCCATC
CGCATCCCGGGTCCGGGTCCACGGGACCCTCGCAAGACAGTGCCTCCGCCACCGATGCCACCATCGGATGGGGCA
CCCGTCCCGTCTGCAGCTCCTGTCGCCGAGGCGTCGGATCTCTTGCTTGACACCAGCCCATCACAAGAGGGAGGG
GACGACGGCGATGCGGACGGGGACGGGGACGGTGATGAGGACTACTCGCAGGCACCTGCATCAGCAGGAGGGGCG
GACCCTTACGCGAACTTGGACGGCGCGTTTGGGAATTACATGGCGGACGAGCCGCGGCCGCAGCAGAGCGGCCCG
TTGTTTTGA
Transcript >RhoplFPRL280|378_2
ATGAGTGGGCAGGGCTCCCAAGATGCGAAGTTCTTCCAGCGGGGCAAGATTCAAGAATTCCGCGCAGAACTCCAG
GCCGCGGAGAGCAAGGACAAGAAGTTCACGAAGCGCAAGACGGTGCTCAAGAAGATTGTTGCCAATATCACTATG
GGAAATGATATGTCCCCGTTGTTCAGTGATGTCATACAATGTTTAAGCATCCCATCACTTGAGATTAAGAAGATG
GTATATCTCTTCTTGGTCTGCTATGGGCGATCCAAGGCGGACCATATCTCCCGCGTCATCCCAAGTTTCCTTGAG
GATTGCGAAGACCGGAACCCACTGGTTCGAGCGTTGGCAATCCGGACTATGTCGTACATCCCCACGTCCCTCGTG
GTAGAGGAGATCGCAGACCCACTACGGCATGCCCTCAAAGACAAGGATCCGTATGTGCGGAAGACGGCAGCCATC
TGTGTAGCAAAGCTTTATACAGCTGATCCTCGAAAAGCCGAGAGGAGTGGTTTCGTGGAGATGTTGCGCGACCTT
CTACTAGACACCAATGCGACTGTCGTAGCGAACGCAGTGGCAGCTTTGTCTGAGATTGGCGACCGTCAGGATGGC
GTCATATTCAGACTCAACCTAACTGTTGCCAACAAACTGCTAGCTGCGCTGGGCGAGAGTTCGGAGTGGGGTCAA
ATTTATATTTTGGACTCATTACTGCGTTACGTTCCTGATCGACACGAGGACGCTGAGCTCATGGCAGAGCGGATT
ATCGTACAAATGCAACATGCTAATTCAGCAGTAGTGCTCACCACGATTAAAGTCTTGCTCTACCTCATGAATTAC
ATGGAGAACCGACGACTAATGGACTACATCTGCAAGAAGATGGGTCCGCCATTAGTCACACTACTGTCGTCTGGT
CCCGAGGTACAATATGTAGCGTTGCGCAATATCCTCCTGATCATTCAACGAAGACCACAAGTGCTCAAGAATGAC
GTCAAGGTCTTCTTCTGCAAGTATAATGACCCAATCTACGTCAAGCTGGCGAAGCTTGAAATCATGTACCGTCTT
GCTCGCGATGAGAACGCGCGAGAGGTCCTCGCTGAACTCCAGGAATATGCTTCGGAAGTCGACATCGATTTCGTG
CGGAAGGCCGTCAGATCGATTGGCCGTCTAGCAATCAAAGTGTCGACGGCTGCAGACGACTGCATCAAGGTCTTG
CTGGAGCTGATCGAGAACAAGGTTACCTACGTCGTGCAAGAAGCCGTCATTGTGATCAAGGACGTTTTCCGACGG
TACCCGGGCAAGTACGAGGGCATTATCCCCGCGCTCTGCGAGAATCTTGACGCGCTGGACGAGCCTGAGTCGAAG
GCGGCCATGATCTGGATTGTCGGCCAGTACGCGAACCGGATAGACAATGCGGACGAGCTGATGGATGACCTCACG
TACACGTTCTTGGATGAGCCTACCGAGGTCCAACTGGCTCTCCTGACCGCCGCAGTGAAGCTCTTCATTTACAAG
GCGCAGTCAGACACGAGCAAAGCACTCGTGCACAAGGTTCTCAAGTGGGCGACCGAAGAAATCGACAACCCAGAC
TTGCGGGACCGGGGCTTCATGTATTGGAGACTGCTCGCAATCAACCCGGCCGTCGCTGGGGAGATCGTCCTTGCC
GAAAAGCCTGCCATCACCACCGACGCAGACAGAATGGACCGCGGGGCGCTGGACCAGCTGCTGTTGCACACCGGC
ACGCTGGGTAGCATATATCACAAGAACCCAGAGACCTTCATTCGGGGTGCAACAGGCAAGGCGCTCACGGACAGC
CCAGCCCTGAACGCGGCGTCACGACAGGTCCTGGTGCCCGTCTCACGAAATAACATGCTGCCCCCGACTGCCATC
CGCATCCCGGGTCCGGGTCCACGGGACCCTCGCAAGACAGTGCCTCCGCCACCGATGCCACCATCGGATGGGGCA
CCCGTCCCGTCTGCAGCTCCTGTCGCCGAGGCGTCGGATCTCTTGCTTGACACCAGCCCATCACAAGAGGGAGGG
GACGACGGCGATGCGGACGGGGACGGGGACGGTGATGAGGACTACTCGCAGGCACCTGCATCAGCAGGAGGGGCG
GACCCTTACGCGAACTTGGACGGCGCGTTTGGGAATTACATGGCGGACGAGCCGCGGCCGCAGCAGAGCGGCCCG
TTGTTTTGA
Gene >RhoplFPRL280|378_2
ATGAGTGGGCAGGGCTCCCAAGATGCGAAGTTCTTCCAGCGGGGCAAGATTCAAGTGCGTTCCCCATCTCGAGTG
TTGTCACCACCTGCTCATTGTGCTTGTCAGGAATTCCGCGCAGAACTCCAGGCCGCGGAGAGCAAGGACAAGAAG
TTCACGAAGCGCAAGACGGTGCTCAAGAAGATTGTTGCCAATATCACTATGGGAAATGATAGTGAGTCCTACTGC
GCCAGATCTGTTCTACCCGTCTCAATTTGTCGGCTTCAGTGTCCCCGTTGTTCAGTGATGTCATACAATGTTTAA
GCATCCCATCACTTGAGATTAAGAAGAGTACGTACTATCAATTCACGCATATCCTAACACGATCAGCGAGAATTC
ATGGCACTCTCATTAGTGGTATATCTCTTCTTGGTCTGCTATGGGCGATCCAAGGCGGACCATATCTCCCGCGTC
ATCCCAAGTTTCCTTGAGGTGAATGCAATTTATTTATCACACAGTTGCAATGTTGAAGCGAAGTCGACCTGTCCA
AGGATTGCGAAGACCGGAACCCACTGGTTCGAGCGTTGGCAATCCGGACTATGTCGTACATCCCCACGTCCCTCG
TGGTAGAGGAGATCGCAGACCCACTACGGCATGCCCTCAAAGACAAGGATCCGTATGTGCGGAAGACGGCAGCCA
TCTGTGTAGCAAAGCTTTATACAGCTGATCCTCGAAAAGCCGAGAGGAGTGGTTTCGTGGAGATGTTGCGCGACC
TTCTACTAGACACCAATGCGACTGTCGTAGCGAACGCAGTGGCAGCTTTGTCTGAGATTGGCGACCGTCAGGATG
GCGTCATATTCAGACTCAACCTAACTGTTGCCAACAAACTGCTAGCTGCGCTGGGCGAGAGTTCGGAGTACGGCT
ATTTCTCCATTCCGCTTCTTTCAGATATTGACCAAGCTCGCAGGTGGGGTCAAATTTATATTTTGGACTCATTAC
TGCGTTACGTTCCTGATCGACACGAGGACGCTGAGCTCATGGCAGAGCGGATTATCGTACAAATGCAACATGCTA
ATTCAGCAGTAGTGCTCACCACGATTAAAGTCTTGCTCTACCTCATGAATTACATGGAGAACCGACGACTAATGG
ACTACATCTGCAAGAAGATGGGTCCGCCATTAGGTATGTCTGATCGATATCATACGTGTTTATGCGCTCGAATCC
TTCCACAGTCACACTACTGTCGTCTGGTCCCGAGGTACAATATGTAGCGTTGCGCAATATCCTCCTGATCATTCA
ACGAAGACCACAAGTGCTCAAGAATGACGTCAAGGTCTTCTTCTGCAAGTATAATGACCCAATCTACGTCAAGCT
GGCGAAGCTTGAAATCATGTACCGTCTTGCTCGCGATGAGAACGCGCGAGAGGTCCTCGCTGAACTCCAGGAGTA
AGTCTGTCGCCGACGCTCCAGGAGAGCCGCGCCGACCCTTACGATGTAGATATGCTTCGGAAGTCGACATCGATT
TCGTGCGGAAGGCCGTCAGATCGATTGGCCGTCTAGCAATCAAAGTGTCGACGGCTGCAGACGACTGCATCAAGG
TCTTGCTGGAGCTGATCGAGAACAAGGTTACCTACGTCGTGCAAGAAGCCGTCATTGTGATCAAGGACGTTTTCC
GACGGTACCCGGGCAAGTACGAGGGCATTATCCCCGCGCTCTGCGAGAATCTTGACGCGCTGGACGAGCCTGAGT
CGAAGGCGGCCATGATCTGGATTGTCGGCCAGTACGCGAACCGGATAGACAATGCGGACGAGCTGATGGATGACC
TCACGTACACGTTCTTGGATGAGCCTACCGAGGTCCGTTCGTTTCCCTTTCCGTCTAGGCTGCAATGTCCTTGAA
TGTGTGCTCTCATGTGCAGGTCCAACTGGCTCTCCTGACCGCCGCAGTGAAGCTCTTCATTTACAAGGCGCAGTC
AGACACGAGCAAAGCACTCGTGCACAAGGTTCTCAAGTGGGCGACCGAAGAAATCGACAACCCAGACTTGCGGGA
CCGGGGCTTCATGTATTGGAGACTGCTCGCAATCAACCCGGCCGTCGCTGGGGAGATCGTCCTTGCCGAAAAGCC
TGCCATCACCACCGACGCAGACAGAATGGACCGCGGGGCGCTGGACCAGCTGCTGTTGCACACCGGCACGCTGGG
TAGCATATATCACAAGAACCCAGAGGTCAGTGCACTCGACTGTTCTGTCAGCATGCGCGACCATACTAACGGGGA
CGTGACGCAGACCTTCATTCGGGGTGCAACAGGCAAGGCGCTCACGGACAGCCCAGCCCTGAACGCGGCGTCACG
ACAGGTCCTGGTGCCCGTCTCACGAAATAACATGCTGCCCCCGACTGCCATCCGCATCCCGGGTCCGGGTCCACG
GGACCCTCGCAAGACAGTGCCTCCGCCACCGATGCCACCATCGGATGGGGCACCCGTCCCGTCTGCAGCTCCTGT
CGCCGAGGCGTCGGATCTCTTGCTTGACACCAGCCCATCACAAGAGGGAGGGGACGACGGCGATGCGGACGGGGA
CGGGGACGGTGATGAGGACTACTCGCAGGCACCTGCATCAGCAGGAGGGGCGGACCCTTACGCGAACTTGGACGG
CGCGTTTGGGAATTACATGGCGGACGAGCCGCGGCCGCAGCAGAGCGGCCCGTTGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail