Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|33_20
Gene name
LocationNODE_33:67914..69680
Strand+
Gene length (bp)1766
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 5.4E-11 35 315

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 25 0.999597

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH18 2.8E-19 33 315

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup304
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|011100
Agaricus bisporus var bisporus H39 AgabiH39|011110
Agaricus bisporus var bisporus H39 AgabiH39|035190
Agaricus bisporus var bisporus H39 AgabiH39|081510
Agaricus bisporus var bisporus H39 AgabiH39|081540
Agaricus bisporus var bisporus H97 AgabiH97|011100
Agaricus bisporus var bisporus H97 AgabiH97|011110
Agaricus bisporus var bisporus H97 AgabiH97|035190
Agaricus bisporus var bisporus H97 AgabiH97|081510
Agaricus bisporus var bisporus H97 AgabiH97|081540
Rhodonia placenta FPRL280 RhoplFPRL280|2_15
Rhodonia placenta FPRL280 RhoplFPRL280|28_25
Rhodonia placenta FPRL280 RhoplFPRL280|33_20 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|33_20
MGFGRSLLAFALGLSFSGSRLLAKAYDNSRSDNVSVYWGQDSYGASGGAESGWQQNISYYCQDDIIDAIPIAFLN
VFFGEGGEPSIDLANTCSTSSDPVFEGTQLPDCSFLGPDIETCQSAGKIVTISLGGASGSIGFSNESQAEGFANT
IWDLFLGGSSSIRPFGDAVLDGIDLDIEGGSSDYYSNFVASLRSLMDGGSKSVIDAEPFDAVYVQFYNNYCELTN
FDDSNDWDFATWDNWAKETSPNPSVKVYIGAPAASAAAGSGYVDAATLGQIAIETRNNYSSFGGVMLWDASQAYA
NDRYDEQVKNSITEDGSASTTTPTTTSTTSTPTPTTTSSTLTTTTTTAPATTTTSAGSGDCAGVATWVSNVAVSH
QCTRGWIVLTHSE*
Coding >RhoplFPRL280|33_20
ATGGGTTTTGGTCGATCCTTACTGGCATTTGCTCTCGGCCTCTCTTTCTCGGGTTCACGCCTCTTGGCCAAGGCC
TACGATAACAGCCGTTCTGACAATGTGAGTGTCTACTGGGGCCAAGACTCATACGGGGCTAGCGGAGGCGCCGAG
TCTGGTTGGCAGCAGAATATATCTTACTATTGTCAGGATGACATCATCGACGCAATCCCTATCGCTTTCCTGAAC
GTCTTCTTTGGCGAGGGTGGAGAGCCATCCATCGACTTGGCCAACACATGCAGTACGTCGAGCGACCCGGTGTTC
GAGGGCACGCAGCTGCCCGACTGCAGCTTCCTTGGACCGGACATAGAGACGTGCCAAAGCGCGGGGAAGATCGTG
ACCATCAGCCTCGGCGGTGCGAGCGGCTCCATCGGCTTCAGCAACGAGAGCCAGGCGGAGGGGTTCGCGAATACC
ATCTGGGATCTATTCCTTGGCGGCTCGAGCAGCATCCGTCCGTTCGGAGACGCTGTGCTTGATGGGATCGACTTG
GACATTGAGGGGGGCTCCTCAGATTACTACTCCAACTTTGTGGCCTCTCTTCGCTCCTTGATGGACGGGGGAAGC
AAGAGTGTCATCGATGCTGAGCCGTTCGACGCGGTCTACGTGCAATTCTACAACAACTATTGCGAGCTTACGAAC
TTTGACGACTCGAATGATTGGGACTTCGCAACCTGGGACAATTGGGCTAAGGAGACCTCGCCCAACCCTAGTGTC
AAGGTCTACATCGGGGCGCCCGCTGCGTCTGCAGCGGCCGGATCAGGGTACGTTGATGCGGCGACGCTCGGTCAG
ATCGCTATCGAAACGCGCAACAATTACTCCTCATTCGGCGGCGTCATGTTGTGGGACGCTTCCCAAGCCTATGCG
AATGACCGCTACGACGAGCAAGTTAAGAACTCGATCACGGAAGACGGGAGCGCGTCGACAACTACGCCTACAACC
ACTAGCACGACTTCGACCCCGACTCCGACTACTACGTCATCGACATTGACAACGACAACGACAACAGCGCCTGCG
ACCACGACGACATCGGCCGGGTCTGGAGACTGCGCCGGGGTCGCCACCTGGGTCTCCAACGTTGCAGTAAGTCAC
CAATGCACCCGAGGCTGGATAGTGCTGACACATTCGGAGTAG
Transcript >RhoplFPRL280|33_20
ATGGGTTTTGGTCGATCCTTACTGGCATTTGCTCTCGGCCTCTCTTTCTCGGGTTCACGCCTCTTGGCCAAGGCC
TACGATAACAGCCGTTCTGACAATGTGAGTGTCTACTGGGGCCAAGACTCATACGGGGCTAGCGGAGGCGCCGAG
TCTGGTTGGCAGCAGAATATATCTTACTATTGTCAGGATGACATCATCGACGCAATCCCTATCGCTTTCCTGAAC
GTCTTCTTTGGCGAGGGTGGAGAGCCATCCATCGACTTGGCCAACACATGCAGTACGTCGAGCGACCCGGTGTTC
GAGGGCACGCAGCTGCCCGACTGCAGCTTCCTTGGACCGGACATAGAGACGTGCCAAAGCGCGGGGAAGATCGTG
ACCATCAGCCTCGGCGGTGCGAGCGGCTCCATCGGCTTCAGCAACGAGAGCCAGGCGGAGGGGTTCGCGAATACC
ATCTGGGATCTATTCCTTGGCGGCTCGAGCAGCATCCGTCCGTTCGGAGACGCTGTGCTTGATGGGATCGACTTG
GACATTGAGGGGGGCTCCTCAGATTACTACTCCAACTTTGTGGCCTCTCTTCGCTCCTTGATGGACGGGGGAAGC
AAGAGTGTCATCGATGCTGAGCCGTTCGACGCGGTCTACGTGCAATTCTACAACAACTATTGCGAGCTTACGAAC
TTTGACGACTCGAATGATTGGGACTTCGCAACCTGGGACAATTGGGCTAAGGAGACCTCGCCCAACCCTAGTGTC
AAGGTCTACATCGGGGCGCCCGCTGCGTCTGCAGCGGCCGGATCAGGGTACGTTGATGCGGCGACGCTCGGTCAG
ATCGCTATCGAAACGCGCAACAATTACTCCTCATTCGGCGGCGTCATGTTGTGGGACGCTTCCCAAGCCTATGCG
AATGACCGCTACGACGAGCAAGTTAAGAACTCGATCACGGAAGACGGGAGCGCGTCGACAACTACGCCTACAACC
ACTAGCACGACTTCGACCCCGACTCCGACTACTACGTCATCGACATTGACAACGACAACGACAACAGCGCCTGCG
ACCACGACGACATCGGCCGGGTCTGGAGACTGCGCCGGGGTCGCCACCTGGGTCTCCAACGTTGCAGTAAGTCAC
CAATGCACCCGAGGCTGGATAGTGCTGACACATTCGGAGTAG
Gene >RhoplFPRL280|33_20
ATGGGTTTTGGTCGATCCTTACTGGCATTTGCTCTCGGCCTCTCTTTCTCGGGTTCACGCCTCTTGGCCAAGGCC
TACGATAACAGCCGTTCTGACAATGTGAGTGTATGCGAGGCTGTCCGTCTTCCACGGCGCTGATAGACATACGTA
TTGTAGCTTGCTGTGTGAGTTGTCAAAATCCACTACACTAAGGGGAACTCATGATCGTCCGTCAGCTACTGGGGC
CAAGACTCATACGGGGCTAGCGGAGGCGCCGAGTCTGGTTGGCAGCAGAATATATCTTACTATTGTCAGGTCTGT
CGTATGCGTCGTGATCTTGATTCTCGTAACATCCCCACCGCACAGGATGACATCATCGACGCAATCCCTATCGCT
TTCCTGAACGTCTTCTTTGGCGAGGGTGGAGAGCCATCCATCGACTTGGCCAACGTCCGTCGCTCTCTCTCCCTC
CTGATGCGACCCACTAACCACCCTGCTTATCGCCTCCCCTTTGCAGACATGCAGTACGTCGAGCGACCCGGTGTT
CGAGGGCACGCAGCTGCCCGACTGCAGCTTCCTTGGACCGGACATAGAGACGTGCCAAAGCGCGGGGAAGATCGT
GACCATCAGCCTCGGCGGTGCGAGCGGCTCCATCGGCTTCAGCAACGAGAGCCAGGCGGAGGGGTTCGCGAATAC
CATCTGGGATCTATTCCTTGGCGGCTCGAGCAGCATCCGTCCGTTCGGAGACGCTGTGCTTGATGGGTATGTGAT
GGATGCCGATCCTACGTGCTGTTCTCATGCGTTAGCATAGGATCGACTTGGACATTGAGGGGGGCTCCTCAGATT
ACTACTCCAACTTTGTGGCCTCTCTTCGCTCCTTGATGGACGGGGGAAGCAAGAGGTGAGTCTGATGTCCGCCGG
CGTCTGAGGTCGGCCCAAGCTCATGATCAACATAGTTATTACATAACAGCTGCTCCTCAATGCCCCTTCCCTGAT
GCATATGTCGGAAGGTATTCAATCCAGAGTTGACGAGCATGTTTGTGATTTTTAATCCCTGCATTAGTGTCATCG
ATGCTGAGCCGTTCGACGCGGTCTACGTGCAATTCTGTAAGTTGCATTCCCTAACACACCAGCTCCGCCCTCACA
ATGGATCCTAGACAACAACTATTGCGAGCTTACGAACTTTGACGACTCGAATGATTGGGACTTCGCAACCTGGTG
AGTGCATACTACTCCTGTGCTGGGATCGAACTGATAAGAAGACGCTTCAGGGACAATTGGGCTAAGGAGACCTCG
CCCAACCCTAGTGTCAAGGTCTACATCGGGGCGCCCGCTGCGTCTGCAGCGGCCGGATCAGGGTACGTTGATGCG
GCGACGCTCGGTCAGATCGCTATCGAAACGCGCAACAATTACTCCTCATTCGGCGGCGTCATGTTGTGGGACGCT
TCCCAAGCCTATGGTACGCTTTATTCGAGGCCGCACAGAGAGCCGAACATGCGCTTAAATGTCGCCTCTTAGCGA
ATGACCGCTACGACGAGCAAGTTAAGAACTCGATCACGGAAGACGGGAGCGCGTCGACAACTACGCCTACAACCA
CTAGCACGACTTCGACCCCGACTCCGACTACTACGTCATCGACATTGACAACGACAACGACAACAGCGCCTGCGA
CCACGACGACATCGGCCGGGTCTGGAGACTGCGCCGGGGTCGCCACCTGGGTCTCCAACGTTGCAGTAAGTCACC
AATGCACCCGAGGCTGGATAGTGCTGACACATTCGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail