Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|335_7
Gene name
LocationNODE_335:8173..9510
Strand+
Gene length (bp)1337
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.8E-09 8 241
PF13460 NAD_binding_10 NAD(P)H-binding 3.8E-09 12 87
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 2.3E-06 8 94
PF03435 Sacchrp_dh_NADP Saccharopine dehydrogenase NADP binding domain 3.2E-06 8 82
PF05368 NmrA NmrA-like family 3.3E-06 8 82
PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase 1.4E-05 4 91
PF07993 NAD_binding_4 Male sterility protein 3.1E-04 11 50

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:0051287 NAD binding Yes
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup152
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|071030
Agaricus bisporus var bisporus H39 AgabiH39|071040
Agaricus bisporus var bisporus H39 AgabiH39|083920
Agaricus bisporus var bisporus H97 AgabiH97|071030
Agaricus bisporus var bisporus H97 AgabiH97|071040
Agaricus bisporus var bisporus H97 AgabiH97|083920
Rhodonia placenta FPRL280 RhoplFPRL280|233_5
Rhodonia placenta FPRL280 RhoplFPRL280|287_8
Rhodonia placenta FPRL280 RhoplFPRL280|335_4
Rhodonia placenta FPRL280 RhoplFPRL280|335_6
Rhodonia placenta FPRL280 RhoplFPRL280|335_7 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|509_3
Rhodonia placenta FPRL280 RhoplFPRL280|594_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|335_7
MSTSKTNIFLIGATGYIGGSILTRLLKHTSANAFDITVLVRSAEKAKVLQDKFSVKAVVGSNEDLDKLEALSEQS
HVVFSCADAGNLAAIEAILRGLKKRRTSTGGLPILIHTSGTAVIATQAKGMFSSDTIYSDTDVDQIKSIPPTAPH
KDVDLAVIAADEEGYARTYTILPSTIYGQAKGALFDAGISNSTSIQIPYLIRAALGRKQGGVVGQGKAIWPDVHI
DDVADLYIVLLDAITENQAGVSHGWEGIYFGENGEHTWYDISKAISKALVELGVGGTDEPTSFTDEELAKYWGSV
DVGNFNGTNARCRADRGRSIGWKPKYTTADMLASIKPEVALLLEKA*
Coding >RhoplFPRL280|335_7
ATGTCAACTTCGAAGACCAACATCTTCCTGATCGGCGCGACAGGCTACATTGGCGGCTCGATCCTCACACGCCTT
CTTAAACACACCAGTGCGAACGCCTTTGACATTACCGTGCTCGTACGCTCCGCGGAGAAAGCAAAGGTGCTCCAG
GACAAGTTTAGCGTCAAGGCCGTTGTGGGCTCCAATGAAGACCTCGATAAGCTCGAGGCACTCTCTGAACAATCG
CACGTCGTCTTCTCCTGCGCAGATGCGGGCAACCTTGCCGCCATTGAGGCGATCCTGCGAGGCTTGAAGAAGCGG
CGCACGTCGACTGGCGGTCTTCCCATTCTAATTCACACTTCGGGCACGGCCGTGATAGCCACGCAGGCTAAGGGC
ATGTTCAGCTCGGACACCATCTACTCTGACACCGACGTCGACCAGATCAAGTCTATACCCCCCACCGCGCCGCAC
AAGGACGTCGATCTTGCTGTTATTGCTGCTGACGAAGAAGGCTACGCACGGACCTACACCATCCTGCCGTCGACG
ATCTACGGCCAGGCGAAGGGTGCCCTGTTCGACGCCGGCATCTCGAACTCAACTTCTATCCAGATTCCGTACCTC
ATCCGCGCTGCGCTCGGCCGCAAGCAGGGCGGCGTCGTCGGCCAGGGCAAGGCGATCTGGCCAGACGTCCACATC
GACGATGTGGCAGACCTGTACATCGTCCTGCTCGACGCGATCACAGAAAATCAAGCGGGCGTCAGCCACGGTTGG
GAGGGCATCTACTTTGGCGAGAACGGCGAGCACACGTGGTACGACATCAGCAAGGCGATCTCGAAGGCGCTTGTC
GAGCTCGGTGTCGGTGGCACGGACGAGCCGACGAGCTTCACGGACGAGGAGCTCGCGAAGTACTGGGGCTCGGTG
GATGTGGGAAACTTTAATGGCACGAATGCGCGTTGCAGGGCTGACCGCGGCCGGTCGATTGGTTGGAAACCGAAG
TACACGACGGCGGATATGCTTGCGAGCATCAAGCCTGAGGTTGCGCTGTTGTTGGAAAAGGCCTAA
Transcript >RhoplFPRL280|335_7
ATGTCAACTTCGAAGACCAACATCTTCCTGATCGGCGCGACAGGCTACATTGGCGGCTCGATCCTCACACGCCTT
CTTAAACACACCAGTGCGAACGCCTTTGACATTACCGTGCTCGTACGCTCCGCGGAGAAAGCAAAGGTGCTCCAG
GACAAGTTTAGCGTCAAGGCCGTTGTGGGCTCCAATGAAGACCTCGATAAGCTCGAGGCACTCTCTGAACAATCG
CACGTCGTCTTCTCCTGCGCAGATGCGGGCAACCTTGCCGCCATTGAGGCGATCCTGCGAGGCTTGAAGAAGCGG
CGCACGTCGACTGGCGGTCTTCCCATTCTAATTCACACTTCGGGCACGGCCGTGATAGCCACGCAGGCTAAGGGC
ATGTTCAGCTCGGACACCATCTACTCTGACACCGACGTCGACCAGATCAAGTCTATACCCCCCACCGCGCCGCAC
AAGGACGTCGATCTTGCTGTTATTGCTGCTGACGAAGAAGGCTACGCACGGACCTACACCATCCTGCCGTCGACG
ATCTACGGCCAGGCGAAGGGTGCCCTGTTCGACGCCGGCATCTCGAACTCAACTTCTATCCAGATTCCGTACCTC
ATCCGCGCTGCGCTCGGCCGCAAGCAGGGCGGCGTCGTCGGCCAGGGCAAGGCGATCTGGCCAGACGTCCACATC
GACGATGTGGCAGACCTGTACATCGTCCTGCTCGACGCGATCACAGAAAATCAAGCGGGCGTCAGCCACGGTTGG
GAGGGCATCTACTTTGGCGAGAACGGCGAGCACACGTGGTACGACATCAGCAAGGCGATCTCGAAGGCGCTTGTC
GAGCTCGGTGTCGGTGGCACGGACGAGCCGACGAGCTTCACGGACGAGGAGCTCGCGAAGTACTGGGGCTCGGTG
GATGTGGGAAACTTTAATGGCACGAATGCGCGTTGCAGGGCTGACCGCGGCCGGTCGATTGGTTGGAAACCGAAG
TACACGACGGCGGATATGCTTGCGAGCATCAAGCCTGAGGTTGCGCTGTTGTTGGAAAAGGCCTAA
Gene >RhoplFPRL280|335_7
ATGTCAACTTCGAAGACCAACATCTTCCTGATCGGCGCGACAGGTGCGTCTCTGATTGCCTTTTCCATTGAGATA
GGGCATCTCAAAATGCTGATTGCGATCTACAGGCTACATTGGCGGCTCGATCCTCACACGCCTTCTTAAACACAC
CAGTGCGAACGCCTTTGACATTACCGTGCTCGTACGCTCCGCGGAGAAAGCAAAGGTGCTCCAGGACAAGTTTAG
CGTCAAGGCCGTTGTGGGCTCCAATGAAGACCTCGATAAGCTCGAGGCACTCTCTGAACAATCGCACGTCGTCTT
CTCCTGCGCAGATGCGGGCAACCTTGCCGCCATTGAGGCGATCCTGCGAGGCTTGAAGAAGCGGCGCACGTCGAC
TGGCGGTCTTCCCATTCTAATTCACACTGTACGTGCTCAAACGACGTTGATCCTGGCACTCAGCGCTGACAGTGA
GACTGGCAGTCGGGCACGGCCGTGATAGCCACGCAGGCTAAGGGCATGTTCAGCTCGGACACCATCTACTCTGAC
ACCGACGTCGACCAGATCAAGTCTATACCCCCCACCGCGCCGCACAAGGACGTCGATCTTGCTGTTATTGCTGCT
GACGAAGAAGGTGTGTACTTGAGTACACTCACCTCTCCCCGCATCCATCAAACTCAAGCATGATTTGAAGGCTAC
GCACGGACCTACACCATCCTGCCGTCGACGATCTACGGCCAGGCGAAGGGTGCCCTGTTCGACGCCGGCATCTCG
AACTCAACTTCTATCCAGATTCCGTACCTCATCCGCGCTGCGCTCGGCCGCAAGCAGGGCGGCGTCGTCGGCCAG
GGCAAGGCGATCTGGCCAGACGTCCACATCGACGATGGTATGTTGCTTGCTATCCATCCTACCCGTCGGCCCGGT
GCTGACCAGGTGCTATCGCAGTGGCAGACCTGTACATCGTCCTGCTCGACGCGATCACAGAAAATCAAGCGGGCG
TCAGCCACGGTTGGGAGGGCATCTACTTTGGCGAGAACGGCGAGCACACGTGGTACGACATCAGCAAGGCGATCT
CGAAGGCGCTTGTCGAGCTCGGTGTCGGTGGCACGGACGAGCCGACGAGCTTCACGGACGAGGAGCTCGCGAAGT
ACTGGGGCTCGGTGGTGAGTTACAGCCATCCCCAGCCTATATCACAGACTTGCTGATGTTCCGTCATGCAGGATG
TGGGAAACTTTAATGGCACGAATGCGCGTTGCAGGGCTGACCGCGGCCGGTCGATTGGTTGGAAACCGAAGTACA
CGACGGCGGATATGCTTGCGAGCATCAAGCCTGAGGTTGCGCTGTTGTTGGAAAAGGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail