Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|335_4
Gene name
LocationNODE_335:17258..18836
Strand+
Gene length (bp)1578
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 2.3E-08 12 86
PF05368 NmrA NmrA-like family 2.4E-07 8 83
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 4.6E-06 8 94

GO

GO Term Description Terminal node
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:0051287 NAD binding Yes
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup152
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|071030
Agaricus bisporus var bisporus H39 AgabiH39|071040
Agaricus bisporus var bisporus H39 AgabiH39|083920
Agaricus bisporus var bisporus H97 AgabiH97|071030
Agaricus bisporus var bisporus H97 AgabiH97|071040
Agaricus bisporus var bisporus H97 AgabiH97|083920
Rhodonia placenta FPRL280 RhoplFPRL280|233_5
Rhodonia placenta FPRL280 RhoplFPRL280|287_8
Rhodonia placenta FPRL280 RhoplFPRL280|335_4 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|335_6
Rhodonia placenta FPRL280 RhoplFPRL280|335_7
Rhodonia placenta FPRL280 RhoplFPRL280|509_3
Rhodonia placenta FPRL280 RhoplFPRL280|594_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|335_4
MSPSKTNIFLIGATGYIGGSVLTRLQSHASANTFDITVLVRSAEKAKVLQEKFGVKTVVGSNEDLDKLEALSEQS
HVVFSCADADNLPAIEAILRGLRKRHASIGDLPTLIHTSGTGEIATQAKGMFASDTIYSDTDVDQIKSIPPTALH
RDVDLAIVAADEQGYARTHIILPSTIYGQAKGPLFDAGVSNPFSIQIPNLIRASIGRKQGGVVGQGKAIWPDVHI
DDVSDLYIVLFDAITTNPEGVGHGFEGFYFGENGEHTWYDISKAISKALVELGVGGTDEPTSFTDEELAKYWGSV
DAGNYSGTNSRCRANRSRSIGWKPKYTTADMLASIKPEVALLWEKAQKEGGVQLSTSRLHFKTFDDSSMEPTTKS
S*
Coding >RhoplFPRL280|335_4
ATGTCACCTTCGAAGACCAACATCTTCCTGATCGGCGCGACAGGCTATATTGGCGGCTCTGTCCTCACACGCCTT
CAGAGCCACGCCAGCGCGAACACCTTTGACATTACCGTGCTCGTACGCTCCGCGGAGAAGGCAAAGGTGCTCCAG
GAGAAGTTCGGCGTCAAGACCGTCGTAGGGTCCAACGAGGACCTTGACAAGCTCGAGGCACTCTCTGAACAATCG
CACGTTGTCTTCTCTTGCGCAGATGCAGACAACCTGCCAGCCATCGAGGCGATCCTGCGCGGCTTGAGGAAGCGG
CACGCGTCGATTGGAGACCTGCCCACTCTCATCCATACATCAGGTACAGGCGAGATCGCCACGCAGGCCAAGGGC
ATGTTCGCCTCGGACACCATCTACTCTGACACCGACGTCGACCAGATCAAGTCTATACCCCCCACCGCGCTGCAC
AGGGACGTGGACCTTGCTATCGTGGCTGCCGACGAGCAAGGTTACGCACGAACTCACATAATCCTGCCGTCGACC
ATCTACGGCCAGGCGAAGGGCCCCCTATTTGACGCAGGCGTCTCGAACCCATTCTCAATCCAGATTCCTAACCTC
ATCCGCGCGTCGATCGGCCGCAAGCAGGGCGGCGTCGTCGGCCAGGGCAAGGCGATCTGGCCGGATGTCCACATC
GACGATGTGTCGGACCTGTACATCGTTCTCTTCGACGCGATCACGACGAACCCGGAGGGAGTTGGGCATGGCTTT
GAGGGCTTCTACTTCGGCGAGAATGGCGAGCACACGTGGTACGACATCAGCAAGGCGATCTCGAAGGCGCTCGTC
GAGCTCGGGGTCGGTGGCACGGATGAGCCGACAAGCTTCACGGACGAGGAGCTCGCGAAGTACTGGGGCTCGGTG
GATGCGGGAAACTATAGTGGTACGAACTCGCGTTGCAGGGCTAATCGCAGCCGGTCGATTGGCTGGAAGCCGAAG
TACACGACGGCAGATATGCTTGCAAGCATCAAGCCTGAGGTTGCGCTGTTGTGGGAAAAAGCCCAGAAGGAGGGT
GGTGTGCAGCTATCTACTTCGCGATTACACTTCAAGACGTTCGATGACAGCAGCATGGAACCTACCACCAAGTCT
TCGTAG
Transcript >RhoplFPRL280|335_4
ATGTCACCTTCGAAGACCAACATCTTCCTGATCGGCGCGACAGGCTATATTGGCGGCTCTGTCCTCACACGCCTT
CAGAGCCACGCCAGCGCGAACACCTTTGACATTACCGTGCTCGTACGCTCCGCGGAGAAGGCAAAGGTGCTCCAG
GAGAAGTTCGGCGTCAAGACCGTCGTAGGGTCCAACGAGGACCTTGACAAGCTCGAGGCACTCTCTGAACAATCG
CACGTTGTCTTCTCTTGCGCAGATGCAGACAACCTGCCAGCCATCGAGGCGATCCTGCGCGGCTTGAGGAAGCGG
CACGCGTCGATTGGAGACCTGCCCACTCTCATCCATACATCAGGTACAGGCGAGATCGCCACGCAGGCCAAGGGC
ATGTTCGCCTCGGACACCATCTACTCTGACACCGACGTCGACCAGATCAAGTCTATACCCCCCACCGCGCTGCAC
AGGGACGTGGACCTTGCTATCGTGGCTGCCGACGAGCAAGGTTACGCACGAACTCACATAATCCTGCCGTCGACC
ATCTACGGCCAGGCGAAGGGCCCCCTATTTGACGCAGGCGTCTCGAACCCATTCTCAATCCAGATTCCTAACCTC
ATCCGCGCGTCGATCGGCCGCAAGCAGGGCGGCGTCGTCGGCCAGGGCAAGGCGATCTGGCCGGATGTCCACATC
GACGATGTGTCGGACCTGTACATCGTTCTCTTCGACGCGATCACGACGAACCCGGAGGGAGTTGGGCATGGCTTT
GAGGGCTTCTACTTCGGCGAGAATGGCGAGCACACGTGGTACGACATCAGCAAGGCGATCTCGAAGGCGCTCGTC
GAGCTCGGGGTCGGTGGCACGGATGAGCCGACAAGCTTCACGGACGAGGAGCTCGCGAAGTACTGGGGCTCGGTG
GATGCGGGAAACTATAGTGGTACGAACTCGCGTTGCAGGGCTAATCGCAGCCGGTCGATTGGCTGGAAGCCGAAG
TACACGACGGCAGATATGCTTGCAAGCATCAAGCCTGAGGTTGCGCTGTTGTGGGAAAAAGCCCAGAAGGAGGGT
GGTGTGCAGCTATCTACTTCGCGATTACACTTCAAGACGTTCGATGACAGCAGCATGGAACCTACCACCAAGTCT
TCGTAG
Gene >RhoplFPRL280|335_4
ATGTCACCTTCGAAGACCAACATCTTCCTGATCGGCGCGACAGGTGCGTATCTGGTTGCTTTTTGCATTGATGTA
GTAAGAGCATCTCGGAATGCTCACTACGATCTACAGGCTATATTGGCGGCTCTGTCCTCACACGCCTTCAGAGCC
ACGCCAGCGCGAACACCTTTGACATTACCGTGCTCGTACGCTCCGCGGAGAAGGCAAAGGTGCTCCAGGAGAAGT
TCGGCGTCAAGACCGTCGTAGGGTCCAACGAGGACCTTGACAAGCTCGAGGCACTCTCTGAACAATCGCACGTTG
TCTTCTCTTGCGCAGATGCAGACAACCTGCCAGCCATCGAGGCGATCCTGCGCGGCTTGAGGAAGCGGCACGCGT
CGATTGGAGACCTGCCCACTCTCATCCATACAGTACGTGATTATCTCGCATCTACCCCGGGACTCTGCACTCATG
GCGGAATTTGCAGTCAGGTACAGGCGAGATCGCCACGCAGGCCAAGGGCATGTTCGCCTCGGACACCATCTACTC
TGACACCGACGTCGACCAGATCAAGTCTATACCCCCCACCGCGCTGCACAGGGACGTGGACCTTGCTATCGTGGC
TGCCGACGAGCAAGGTGCGTGCCCAAAAGCACCCCCCTCTCTCCGTCCATCGCACTCAAGCATGACTTGCAGGTT
ACGCACGAACTCACATAATCCTGCCGTCGACCATCTACGGCCAGGCGAAGGGCCCCCTATTTGACGCAGGCGTCT
CGAACCCATTCTCAATCCAGATTCCTAACCTCATCCGCGCGTCGATCGGCCGCAAGCAGGGCGGCGTCGTCGGCC
AGGGCAAGGCGATCTGGCCGGATGTCCACATCGACGATGGTGTGTTTACTGGCCATCCTTTCCACCCCGTCGACC
TGGCGCTGACCAGGTGTTCTCACAGTGTCGGACCTGTACATCGTTCTCTTCGACGCGATCACGACGAACCCGGAG
GGAGTTGGGCATGGCTTTGAGGGCTTCTACTTCGGCGAGAATGGCGAGCACACGTGGTACGACATCAGCAAGGCG
ATCTCGAAGGCGCTCGTCGAGCTCGGGGTCGGTGGCACGGATGAGCCGACAAGCTTCACGGACGAGGAGCTCGCG
AAGTACTGGGGCTCGGTGGTGAGTAACAGCCATCTCCAGCCTACACTTCAGGTTCGCTGAATGTTCCACCGTGCA
GGATGCGGGAAACTATAGTGGTACGAACTCGCGTTGCAGGGCTAATCGCAGCCGGTCGATTGGCTGGAAGCCGAA
GTACACGACGGCAGATATGCTTGCAAGCATCAAGCCTGAGGTTGCGCTGTTGTGGGAAAAAGCCCAGAAGGAGGG
TGGTGTGCAGCTATCTACTTCGCGGTGAGCATGAGGGAAAGGTTTTGAGGAGAAGTCCTTTTTTGCGCCTGTCCA
CTCGTACGGGGCGGCCTATGCATTATAGCGCATTTCATACACGAAGGACGAATTTTGGAACAGCTGTGACCAACT
CGATAGACCTCCTCTCGCAGATTACACTTCAAGACGTTCGATGACAGCAGCATGGAACCTACCACCAAGTCTTCG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail