Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|330_7
Gene name
LocationNODE_330:26000..27111
Strand-
Gene length (bp)1111
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 3.6E-09 20 83

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999746

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup817
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|306400
Agaricus bisporus var bisporus H97 AgabiH97|065230
Rhodonia placenta FPRL280 RhoplFPRL280|330_7 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|515_4
Rhodonia placenta FPRL280 RhoplFPRL280|678_1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|330_7
MLVRTLVLAALLGAAAAQTSGIDPCVLSCLQSAVSSSSCSSYTDISCVCSSTAFQEAAAECLASKCTTAEQQAAL
ALQSAECAASATSAATSAATSAASKASSDVSSAVSAASSGTSPAASTASSGTFSAASAGLSGAFSATSAASSSAT
SAASASSGASSEAPATLSGASSAASAASSSVFFTASAASADVSSATFAALSGASSAASAALSGASSAASAALSGA
SSAASASGASSAASAASSGASSATSAASSGASTSKSAGAAVRLERGTVVGVLVALAGVGAGAALVL*
Coding >RhoplFPRL280|330_7
ATGCTCGTCAGGACGCTTGTCCTCGCCGCCCTCCTTGGCGCCGCCGCCGCCCAGACCAGTGGCATCGACCCTTGC
GTCCTCTCCTGCCTCCAGAGCGCCGTTTCCTCAAGCAGCTGCTCCAGCTACACGGACATATCCTGCGTGTGCTCG
TCCACCGCGTTCCAGGAGGCGGCGGCCGAGTGCCTCGCGAGCAAGTGCACCACGGCCGAGCAGCAGGCCGCCCTC
GCCCTCCAATCAGCAGAGTGTGCCGCCTCCGCGACCTCTGCTGCGACCTCTGCTGCGACCTCTGCAGCCTCCAAG
GCATCGTCAGATGTGTCCTCTGCAGTCTCCGCGGCGTCGTCAGGCACGTCTCCTGCAGCCTCCACGGCATCGTCA
GGAACATTCTCTGCAGCCTCCGCGGGGTTGTCGGGTGCATTCTCTGCAACCTCTGCGGCGTCGTCGAGCGCGACC
TCTGCCGCCTCCGCGTCGTCAGGCGCGTCCTCTGAAGCCCCCGCTACGTTGTCGGGTGCATCCTCTGCCGCCTCC
GCGGCGTCGTCAAGCGTATTTTTTACAGCCTCTGCGGCGTCGGCGGATGTATCCTCCGCTACCTTCGCGGCGTTG
TCGGGTGCATCATCTGCAGCCTCCGCGGCGTTGTCGGGAGCGTCGTCTGCCGCCTCCGCGGCATTGTCGGGCGCA
TCCTCTGCAGCTTCCGCGTCAGGAGCGTCCTCTGCAGCCTCAGCAGCGTCGTCGGGTGCATCCTCCGCTACCTCT
GCGGCGTCGTCCGGCGCGTCGACGAGCAAGAGCGCCGGCGCGGCGGTGCGCCTGGAGCGGGGCACCGTCGTGGGC
GTGCTCGTCGCGCTCGCGGGCGTCGGCGCCGGCGCTGCACTGGTGCTGTGA
Transcript >RhoplFPRL280|330_7
ATGCTCGTCAGGACGCTTGTCCTCGCCGCCCTCCTTGGCGCCGCCGCCGCCCAGACCAGTGGCATCGACCCTTGC
GTCCTCTCCTGCCTCCAGAGCGCCGTTTCCTCAAGCAGCTGCTCCAGCTACACGGACATATCCTGCGTGTGCTCG
TCCACCGCGTTCCAGGAGGCGGCGGCCGAGTGCCTCGCGAGCAAGTGCACCACGGCCGAGCAGCAGGCCGCCCTC
GCCCTCCAATCAGCAGAGTGTGCCGCCTCCGCGACCTCTGCTGCGACCTCTGCTGCGACCTCTGCAGCCTCCAAG
GCATCGTCAGATGTGTCCTCTGCAGTCTCCGCGGCGTCGTCAGGCACGTCTCCTGCAGCCTCCACGGCATCGTCA
GGAACATTCTCTGCAGCCTCCGCGGGGTTGTCGGGTGCATTCTCTGCAACCTCTGCGGCGTCGTCGAGCGCGACC
TCTGCCGCCTCCGCGTCGTCAGGCGCGTCCTCTGAAGCCCCCGCTACGTTGTCGGGTGCATCCTCTGCCGCCTCC
GCGGCGTCGTCAAGCGTATTTTTTACAGCCTCTGCGGCGTCGGCGGATGTATCCTCCGCTACCTTCGCGGCGTTG
TCGGGTGCATCATCTGCAGCCTCCGCGGCGTTGTCGGGAGCGTCGTCTGCCGCCTCCGCGGCATTGTCGGGCGCA
TCCTCTGCAGCTTCCGCGTCAGGAGCGTCCTCTGCAGCCTCAGCAGCGTCGTCGGGTGCATCCTCCGCTACCTCT
GCGGCGTCGTCCGGCGCGTCGACGAGCAAGAGCGCCGGCGCGGCGGTGCGCCTGGAGCGGGGCACCGTCGTGGGC
GTGCTCGTCGCGCTCGCGGGCGTCGGCGCCGGCGCTGCACTGGTGCTGTGA
Gene >RhoplFPRL280|330_7
ATGCTCGTCAGGACGCTTGTCCTCGCCGCCCTCCTTGGCGCCGCCGCCGCCCAGACCAGTGGCATCGACCCTTGC
GTCCTCTCCTGCCTCCAGAGCGCCGTTTCCTCAAGCAGCTGCTCCAGCTAGTGCGTTTTCCCGTTCTCCGCTGCT
GCCCCTTCCTTTTTTATCCAGCGCGACGGCTCACGCACGCGTTCTGCGACCGCCAGCACGGACATATCCTGCGTG
TGCTCGTCCACCGCGTTCCAGGAGGCGGCGGCCGAGTGCCTCGCGAGCAAGTGCACCACGGCCGAGCAGCAGGCC
GCCCTCGCCCTCCAATCAGCAGAGTGTGCTGCCGGTACGCCCTTGTCCCCATCCTCAACTCCCCCCGCCCCTCGC
CCCTCACTCCTCGGAGCGATACCCCATAGCTGCTGTCTCCCGTCCTACCTCACTCCTCTCATAGTGCATCGCGGC
TGATGTATGCACAGCGTCCGCCTCCTCCGGTGCCGCCTCCGCGACCTCTGCTGCGACCTCTGCTGCGACCTCTGC
AGCCTCCAAGGCATCGTCAGATGTGTCCTCTGCAGTCTCCGCGGCGTCGTCAGGCACGTCTCCTGCAGCCTCCAC
GGCATCGTCAGGAACATTCTCTGCAGCCTCCGCGGGGTTGTCGGGTGCATTCTCTGCAACCTCTGCGGCGTCGTC
GAGCGCGACCTCTGCCGCCTCCGCGTCGTCAGGCGCGTCCTCTGAAGCCCCCGCTACGTTGTCGGGTGCATCCTC
TGCCGCCTCCGCGGCGTCGTCAAGCGTATTTTTTACAGCCTCTGCGGCGTCGGCGGATGTATCCTCCGCTACCTT
CGCGGCGTTGTCGGGTGCATCATCTGCAGCCTCCGCGGCGTTGTCGGGAGCGTCGTCTGCCGCCTCCGCGGCATT
GTCGGGCGCATCCTCTGCAGCTTCCGCGTCAGGAGCGTCCTCTGCAGCCTCAGCAGCGTCGTCGGGTGCATCCTC
CGCTACCTCTGCGGCGTCGTCCGGCGCGTCGACGAGCAAGAGCGCCGGCGCGGCGGTGCGCCTGGAGCGGGGCAC
CGTCGTGGGCGTGCTCGTCGCGCTCGCGGGCGTCGGCGCCGGCGCTGCACTGGTGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail