Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|288_3
Gene name
LocationNODE_288:15276..18578
Strand+
Gene length (bp)3302
Transcript length (bp)2829
Coding sequence length (bp)2829
Protein length (aa) 943

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 8.9E-52 4 254
PF00698 Acyl_transf_1 Acyl transferase domain 7.0E-46 518 817
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.0E-24 262 375
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.2E-12 379 496

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|288_3
MPTPIAIVGISAELPSGAHTDSNLNHHEFFDFLLNGKESYERMPHGRFNIEAWKGSNRGEIWVDTGSFLKGIDLF
DNVEFGISARDARTMSPATRKLIEHCFLALVDSGIDYRSRNVGCFTSGTNLELTNVAGPDEYDCEGSFAGYPSMV
SNRVSTHLDLLGPSVPTDTACSSSMTALHLAVQSLYSGDCDAAVVGGCQLNHRQLVVSFVDWFTYSQASLLAPDG
KCKPFDSSADGFSRAEACVAIVLKPLQQALLDEDPIYATILGTAINSCGGSAPPGAPVAEAQRDAMRKAFRLSGR
SPREVDFVELHATGTAKGDPTEANWAGEEFQRDDEILIGSVKGNIGHTEIVAFLASLSKVVSIFQSRLIPPNINI
RSLNPAIRWREYRLCVPQCPIALPCHSERLPLIAMSSSGIGGSNGHAVLEGPPVRASHNTHTSPEADLPKLLISG
GLSSRSVSVVAESIADVASSGACSLSTLSTVLGRRSRSMTWRSFAITDLGRPTFSPPQLCPREARPIVFVFSGQG
PQHQHMGRQLFENFPIFRDSILEMDKTYEALTGSSMLRNHGLFEGYSPNGNFKDVWPISLILPSIAMFQIAFFDL
LTSFGVKPDIVIGHSAGETAMLYASGAAPRSMAFELAVIRGRAFTPLEALGGGMAAISCGEEDAEEIIASVRSEL
PDNILEIACFNSPSAIAIAGHDIAITRALEVCQTRGVFGRKIRTSVPMHSSMMEQCREDYCRELRALFERYPGQH
VPQIPTYSTLTGERLSDSIDADYFWGNTRSPVRFTQAMERLTASQSCTFVEISPHPVLVSYISSMAGDGSPVIST
MHRVKPNMPSVDHVDLLRVCGELTASGFNGVNFTALNNRACYECDVSLPTYPFSKKSYALYPDTPGYAKQMEPHL
GPLNHRYLRINKDTHPVLAEHVIRGEPIMPAAGYIEMVRYPV*
Coding >RhoplFPRL280|288_3
ATGCCGACTCCTATAGCCATAGTTGGTATATCTGCCGAATTGCCTAGTGGAGCTCACACAGACAGTAATCTTAAT
CATCACGAGTTTTTTGACTTCCTGCTCAATGGGAAGGAATCCTACGAGCGCATGCCGCACGGCAGGTTCAATATT
GAGGCGTGGAAGGGCAGCAATCGCGGAGAAATATGGGTGGACACAGGGTCATTTCTCAAGGGAATAGACTTATTC
GACAATGTCGAATTTGGCATTTCTGCGAGAGACGCCCGCACTATGTCACCAGCTACACGAAAGCTCATTGAACAT
TGTTTCTTGGCGCTGGTGGACTCAGGCATCGATTACCGCAGCAGGAACGTCGGTTGTTTCACCTCCGGAACGAAC
CTAGAGTTGACGAATGTCGCTGGTCCAGACGAATACGACTGTGAAGGCTCATTCGCGGGATATCCCTCGATGGTG
TCTAATCGTGTCTCGACTCATCTTGACCTATTGGGTCCATCAGTCCCCACCGATACGGCATGCAGTTCATCCATG
ACGGCACTGCACCTCGCAGTTCAGTCACTGTATAGCGGTGATTGTGATGCTGCTGTAGTGGGCGGATGCCAACTG
AACCATCGGCAACTCGTGGTTAGTTTCGTCGACTGGTTCACGTATAGCCAGGCATCCTTGTTAGCCCCCGATGGC
AAATGCAAGCCGTTTGACTCGTCAGCAGATGGATTTTCCAGAGCAGAAGCCTGTGTAGCGATTGTACTTAAGCCG
CTGCAGCAGGCTTTGTTAGACGAGGACCCTATCTATGCAACGATTCTCGGTACAGCAATCAACTCATGCGGTGGT
AGCGCTCCACCTGGGGCACCCGTCGCGGAGGCGCAGCGAGACGCTATGCGAAAGGCATTTAGGCTATCAGGTAGA
AGCCCTCGCGAAGTTGACTTTGTGGAGTTGCATGCGACAGGGACAGCGAAGGGAGATCCCACGGAAGCCAATTGG
GCTGGAGAGGAGTTCCAGAGAGATGACGAAATCCTCATTGGCAGTGTAAAGGGAAATATCGGGCACACAGAAATT
GTAGCTTTTCTGGCGTCACTGTCGAAAGTCGTATCCATATTCCAATCCCGCCTTATTCCCCCGAACATCAACATA
CGGTCGCTCAACCCTGCAATTCGGTGGAGAGAGTACCGGCTCTGTGTACCCCAATGCCCCATTGCATTGCCCTGT
CATTCAGAGCGTCTTCCTCTGATCGCTATGTCAAGCTCTGGGATCGGTGGCTCCAATGGCCACGCAGTTCTGGAA
GGGCCGCCGGTTCGAGCATCCCACAATACGCACACCTCGCCTGAGGCTGACCTGCCAAAGCTCCTCATCTCCGGC
GGGCTTTCCTCTCGCAGCGTCAGCGTGGTTGCGGAGTCCATCGCAGATGTGGCGTCCAGTGGCGCTTGTAGTTTA
TCTACACTGTCCACTGTGCTTGGACGTCGCTCCCGTTCTATGACCTGGCGCTCGTTTGCGATCACTGACCTGGGT
CGTCCCACGTTCTCGCCACCACAGCTTTGTCCTCGTGAAGCACGCCCCATCGTCTTCGTATTCTCGGGGCAGGGT
CCCCAGCATCAGCACATGGGTCGGCAGCTATTCGAGAATTTCCCCATCTTCCGCGATAGCATACTGGAGATGGAT
AAGACCTACGAGGCATTGACTGGCAGCTCGATGCTACGTAATCACGGCTTGTTTGAGGGCTACTCACCCAACGGG
AACTTCAAGGACGTCTGGCCAATATCGCTCATTCTGCCATCCATTGCGATGTTCCAAATAGCGTTCTTCGATCTC
TTGACCAGCTTCGGCGTCAAGCCAGACATAGTCATTGGCCATTCGGCTGGCGAGACCGCCATGCTCTACGCATCT
GGTGCAGCGCCAAGGTCGATGGCATTCGAGCTGGCCGTCATTCGCGGACGTGCGTTCACACCTCTTGAAGCACTT
GGTGGTGGTATGGCGGCCATATCATGCGGGGAGGAAGACGCAGAGGAAATCATTGCCAGCGTACGCTCAGAACTC
CCGGACAACATCCTCGAGATCGCCTGTTTCAATTCACCGTCTGCCATCGCGATCGCGGGCCACGACATCGCGATC
ACACGGGCGCTGGAGGTCTGTCAGACTCGGGGGGTGTTCGGTCGCAAGATACGCACGAGCGTGCCCATGCACTCG
TCCATGATGGAGCAGTGTCGAGAGGACTACTGCAGAGAGCTCCGAGCACTTTTTGAGCGGTACCCTGGCCAGCAC
GTCCCACAGATCCCGACGTACTCAACATTGACGGGAGAGAGGTTGTCCGACTCGATCGACGCCGACTACTTCTGG
GGGAATACGCGATCGCCCGTACGGTTCACGCAAGCGATGGAAAGGCTTACCGCGTCGCAGTCGTGCACATTTGTA
GAGATTTCACCACATCCTGTCCTGGTGTCCTACATCTCATCCATGGCCGGCGACGGTAGCCCGGTCATATCGACG
ATGCATCGCGTGAAGCCAAATATGCCGTCTGTGGATCATGTCGATCTACTGAGGGTGTGCGGTGAGCTGACCGCC
TCTGGGTTCAATGGCGTCAATTTTACCGCGCTCAACAATCGAGCCTGCTACGAATGCGACGTCTCCCTTCCCACC
TATCCGTTCTCGAAGAAGAGCTACGCACTCTATCCGGACACGCCTGGATATGCGAAACAGATGGAACCCCATCTT
GGACCACTGAACCATCGGTATCTCAGAATTAACAAGGATACGCATCCGGTCCTTGCAGAGCATGTCATCAGAGGA
GAGCCAATCATGCCTGCTGCCGGGTACATCGAGATGGTAAGATATCCTGTCTAG
Transcript >RhoplFPRL280|288_3
ATGCCGACTCCTATAGCCATAGTTGGTATATCTGCCGAATTGCCTAGTGGAGCTCACACAGACAGTAATCTTAAT
CATCACGAGTTTTTTGACTTCCTGCTCAATGGGAAGGAATCCTACGAGCGCATGCCGCACGGCAGGTTCAATATT
GAGGCGTGGAAGGGCAGCAATCGCGGAGAAATATGGGTGGACACAGGGTCATTTCTCAAGGGAATAGACTTATTC
GACAATGTCGAATTTGGCATTTCTGCGAGAGACGCCCGCACTATGTCACCAGCTACACGAAAGCTCATTGAACAT
TGTTTCTTGGCGCTGGTGGACTCAGGCATCGATTACCGCAGCAGGAACGTCGGTTGTTTCACCTCCGGAACGAAC
CTAGAGTTGACGAATGTCGCTGGTCCAGACGAATACGACTGTGAAGGCTCATTCGCGGGATATCCCTCGATGGTG
TCTAATCGTGTCTCGACTCATCTTGACCTATTGGGTCCATCAGTCCCCACCGATACGGCATGCAGTTCATCCATG
ACGGCACTGCACCTCGCAGTTCAGTCACTGTATAGCGGTGATTGTGATGCTGCTGTAGTGGGCGGATGCCAACTG
AACCATCGGCAACTCGTGGTTAGTTTCGTCGACTGGTTCACGTATAGCCAGGCATCCTTGTTAGCCCCCGATGGC
AAATGCAAGCCGTTTGACTCGTCAGCAGATGGATTTTCCAGAGCAGAAGCCTGTGTAGCGATTGTACTTAAGCCG
CTGCAGCAGGCTTTGTTAGACGAGGACCCTATCTATGCAACGATTCTCGGTACAGCAATCAACTCATGCGGTGGT
AGCGCTCCACCTGGGGCACCCGTCGCGGAGGCGCAGCGAGACGCTATGCGAAAGGCATTTAGGCTATCAGGTAGA
AGCCCTCGCGAAGTTGACTTTGTGGAGTTGCATGCGACAGGGACAGCGAAGGGAGATCCCACGGAAGCCAATTGG
GCTGGAGAGGAGTTCCAGAGAGATGACGAAATCCTCATTGGCAGTGTAAAGGGAAATATCGGGCACACAGAAATT
GTAGCTTTTCTGGCGTCACTGTCGAAAGTCGTATCCATATTCCAATCCCGCCTTATTCCCCCGAACATCAACATA
CGGTCGCTCAACCCTGCAATTCGGTGGAGAGAGTACCGGCTCTGTGTACCCCAATGCCCCATTGCATTGCCCTGT
CATTCAGAGCGTCTTCCTCTGATCGCTATGTCAAGCTCTGGGATCGGTGGCTCCAATGGCCACGCAGTTCTGGAA
GGGCCGCCGGTTCGAGCATCCCACAATACGCACACCTCGCCTGAGGCTGACCTGCCAAAGCTCCTCATCTCCGGC
GGGCTTTCCTCTCGCAGCGTCAGCGTGGTTGCGGAGTCCATCGCAGATGTGGCGTCCAGTGGCGCTTGTAGTTTA
TCTACACTGTCCACTGTGCTTGGACGTCGCTCCCGTTCTATGACCTGGCGCTCGTTTGCGATCACTGACCTGGGT
CGTCCCACGTTCTCGCCACCACAGCTTTGTCCTCGTGAAGCACGCCCCATCGTCTTCGTATTCTCGGGGCAGGGT
CCCCAGCATCAGCACATGGGTCGGCAGCTATTCGAGAATTTCCCCATCTTCCGCGATAGCATACTGGAGATGGAT
AAGACCTACGAGGCATTGACTGGCAGCTCGATGCTACGTAATCACGGCTTGTTTGAGGGCTACTCACCCAACGGG
AACTTCAAGGACGTCTGGCCAATATCGCTCATTCTGCCATCCATTGCGATGTTCCAAATAGCGTTCTTCGATCTC
TTGACCAGCTTCGGCGTCAAGCCAGACATAGTCATTGGCCATTCGGCTGGCGAGACCGCCATGCTCTACGCATCT
GGTGCAGCGCCAAGGTCGATGGCATTCGAGCTGGCCGTCATTCGCGGACGTGCGTTCACACCTCTTGAAGCACTT
GGTGGTGGTATGGCGGCCATATCATGCGGGGAGGAAGACGCAGAGGAAATCATTGCCAGCGTACGCTCAGAACTC
CCGGACAACATCCTCGAGATCGCCTGTTTCAATTCACCGTCTGCCATCGCGATCGCGGGCCACGACATCGCGATC
ACACGGGCGCTGGAGGTCTGTCAGACTCGGGGGGTGTTCGGTCGCAAGATACGCACGAGCGTGCCCATGCACTCG
TCCATGATGGAGCAGTGTCGAGAGGACTACTGCAGAGAGCTCCGAGCACTTTTTGAGCGGTACCCTGGCCAGCAC
GTCCCACAGATCCCGACGTACTCAACATTGACGGGAGAGAGGTTGTCCGACTCGATCGACGCCGACTACTTCTGG
GGGAATACGCGATCGCCCGTACGGTTCACGCAAGCGATGGAAAGGCTTACCGCGTCGCAGTCGTGCACATTTGTA
GAGATTTCACCACATCCTGTCCTGGTGTCCTACATCTCATCCATGGCCGGCGACGGTAGCCCGGTCATATCGACG
ATGCATCGCGTGAAGCCAAATATGCCGTCTGTGGATCATGTCGATCTACTGAGGGTGTGCGGTGAGCTGACCGCC
TCTGGGTTCAATGGCGTCAATTTTACCGCGCTCAACAATCGAGCCTGCTACGAATGCGACGTCTCCCTTCCCACC
TATCCGTTCTCGAAGAAGAGCTACGCACTCTATCCGGACACGCCTGGATATGCGAAACAGATGGAACCCCATCTT
GGACCACTGAACCATCGGTATCTCAGAATTAACAAGGATACGCATCCGGTCCTTGCAGAGCATGTCATCAGAGGA
GAGCCAATCATGCCTGCTGCCGGGTACATCGAGATGGTAAGATATCCTGTCTAG
Gene >RhoplFPRL280|288_3
ATGCCGACTCCTATAGCCATAGTATGTTGGCAGCCTCTTGAGTAGCATTCCTACTTACCCATCTTCAGGTTGGTA
TATCTGCCGAATTGCCTAGTGGAGCTCACACAGACAGTAATCTTAATCATCACGAGTTTTTTGACTTCCTGCTCA
ATGGGAAGGAATCCTACGAGCGCATGCCGCACGGCAGGTTCAATATTGAGGCGTGAGTTACAATAGAAGCTTGCT
CATGCCCGTCCTGTTTTGACCCTCATTGATAGGTGGAAGGGCAGCAATCGCGGAGAAATATGGGTGGACACAGGG
TCATTTCTCAAGGGAATAGACTTATTCGACAATGTCGAATTTGGCATTTCTGCGAGAGACGCCCGCACTATGTCA
CCAGCTACACGAAAGCTCATTGAACATTGTTTCTTGGCGCTGGTGGACTCAGGCATCGATTACCGCAGCAGGAAC
GTCGGTTGTTTCACCTCCGGAACGAACCTAGAGTTGACGAATGTCGCTGGTCCAGTAAGTCCCGCTTTCATAGGA
ATTGTAGTCAATCTCAATAGAGGACCGCAGGACGAATACGACTGTGAAGGCTCATTCGCGGGATATCCCTCGATG
GTGTCTAATCGTGTCTCGACTCATCTTGACCTATTGGGTCCATCAGTCCCCACCGATACGGCATGCAGTTCATCC
ATGACGGCACTGCACCTCGCAGTTCAGTCACTGTATAGCGGTGATTGTGATGCTGCTGTAGTGGGCGGATGCCAA
CTGAACCATCGGCAAGTATTGCTCGCCCTTGACGCGGATTCAAGTTCACCTCTGACTAGCTCGTGGTTAGTTTCG
TCGACTGGTTCACGTATAGCCAGGCATCCTTGTTAGCCCCCGATGGCAAATGCAAGCCGTTTGACTCGTCAGCAG
ATGGGTACGGTGCAACTTTTTCAAATGACTTTTCATTTTTACACCTCAGGCAGATTTTCCAGAGCAGAAGCCTGT
GTAGCGATTGTACTTAAGCCGCTGCAGCAGGCTTTGTTAGACGAGGACCCTATCTATGCAACGGTAGTGCCTTCG
TTGTGTCGGAGAGCCGTGCTCTGACTTTGTTGCGTAGATTCTCGGTACAGCAATCAACTCATGCGGTGGTAGCGC
TCCACCTGGGGCACCCGTCGCGGAGGCGCAGCGAGACGCTATGCGAAAGGCATTTAGGCTATCAGGTAGAAGCCC
TCGCGAAGTTGACTTTGTGGAGTTGCATGCGACAGGTAATGTTTTTGCGCATGTTTTCATGAATCGACCGGTCGA
CGTACCAACTTGTCAATTGGTTAGGGACAGCGAAGGGAGATCCCACGGAAGCCAATTGGGCTGGAGAGGAGTTCC
AGAGAGATGACGAAATCCTCATTGGCAGTGTAAAGGGAAATATCGGGTGAGCACCTCAAACGCAACAGACTAATG
CAGCCAGCTGATCGTCTCCATTCGTAGGCACACAGAAATTGTAGCTTTTCTGGCGTCACTGTCGAAAGTCGTATC
CATATTCCAATCCCGCCTTATTCCCCCGAACATCAACATACGGTCGCTCAACCCTGCAATTCGGTGGAGAGAGTA
CCGGCTCTGTGTACCCCAATGCCCCATTGCATTGCCCTGTCATTCAGAGCGTCTTCCTCTGATCGCTATGTCAAG
CTCTGGGATCGGTGGCTCCAATGGCCACGCAGTTCTGGAAGGGCCGCCGGTTCGAGCATCCCACAATACGCACAC
CTCGCCTGAGGCTGACCTGCCAAAGCTCCTCATCTCCGGCGGGCTTTCCTCTCGCAGCGTCAGCGTGGTTGCGGA
GTCCATCGCAGATGTGGCGTCCAGTGGCGCTTGTAGTTTATCTACACTGTCCACTGTGCTTGGACGTCGCTCCCG
TTCTATGACCTGGCGCTCGTTTGCGATCACTGACCTGGGTCGTCCCACGTTCTCGCCACCACAGCTTTGTCCTCG
TGAAGCACGCCCCATCGTCTTCGTATTCTCGGGGCAGGGTCCCCAGCATCAGCACAGTGCGTTCGTTACTCATGT
TAGTCATACGGCCCATGGATGATGCTGATGTCTACTCAGTGGGTCGGCAGCTATTCGAGAATTTCCCCATCTTCC
GCGATAGCATACTGGAGATGGATAAGACCTACGAGGCATTGACTGGCAGCTCGATGCTACGTAATCACGGCTTGT
TTGAGGGCTACTCACCCAACGGGAACTTCAAGGACGTCTGGCCAATATCGCTCATTCTGCCATCCATTGCGATGT
TCCAAATAGCGTTCTTCGATCTCTTGACCAGCTTCGGCGTCAAGCCAGACATAGTCATTGGCCATTCGGCTGGCG
AGACCGCCATGCTCTACGCATCTGGTGCAGCGCCAAGGTCGATGGCATTCGAGCTGGCCGTCATTCGCGGACGTG
CGTTCACACCTCTTGAAGCACTTGGTGGTGGTATGGCGGCCATATCATGCGGGGAGGAAGACGCAGAGGAAATCA
TTGCCAGCGTACGCTCAGAACTCCCGGACAACATCCTCGAGATCGCCTGTTTCAATTCACCGTCTGCCATCGCGA
TCGCGGGCCACGACATCGCGATCACACGGGCGCTGGAGGTCTGTCAGACTCGGGGGGTGTTCGGTCGCAAGATAC
GCACGAGCGTGCCCATGCACTCGTCCATGATGGAGCAGTGTCGAGAGGACTACTGCAGAGAGCTCCGAGCACTTT
TTGAGCGGTACCCTGGCCAGCACGTCCCACAGATCCCGACGTACTCAACATTGACGGGAGAGAGGTTGTCCGACT
CGATCGACGCCGACTACTTCTGGGGGAATACGCGATCGCCCGTACGGTTCACGCAAGCGATGGAAAGGCTTACCG
CGTCGCAGTCGTGCACATTTGTAGAGATTTCACCACATCCTGTCCTGGTGTCCTACATCTCATCCATGGCCGGCG
ACGGTAGCCCGGTCATATCGACGATGCATCGCGTGAAGCCAAATATGCCGTCTGTGGATCATGTCGATCTACTGA
GGGTGTGCGGTGAGCTGACCGCCTCTGGGTTCAATGGCGTCAATTTTACCGCGCTCAACAATCGAGCCTGCTACG
AATGCGACGTCTCCCTTCCCACCTATCCGTTCTCGAAGAAGAGCTACGCACTCTATCCGGACACGCCTGGATATG
CGAAACAGATGGAACCCCATCTTGGACCACTGAACCATCGGTATCTCAGAATTAACAAGGATACGCATCCGGTCC
TTGCAGAGCATGTCATCAGAGGAGAGCCAATCATGCCTGCTGCCGGGTACATCGAGATGGTAAGATATCCTGTCT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail