Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|287_8
Gene name
LocationNODE_287:2225..3453
Strand+
Gene length (bp)1228
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup152
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|071030
Agaricus bisporus var bisporus H39 AgabiH39|071040
Agaricus bisporus var bisporus H39 AgabiH39|083920
Agaricus bisporus var bisporus H97 AgabiH97|071030
Agaricus bisporus var bisporus H97 AgabiH97|071040
Agaricus bisporus var bisporus H97 AgabiH97|083920
Rhodonia placenta FPRL280 RhoplFPRL280|233_5
Rhodonia placenta FPRL280 RhoplFPRL280|287_8 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|335_4
Rhodonia placenta FPRL280 RhoplFPRL280|335_6
Rhodonia placenta FPRL280 RhoplFPRL280|335_7
Rhodonia placenta FPRL280 RhoplFPRL280|509_3
Rhodonia placenta FPRL280 RhoplFPRL280|594_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|287_8
MEAILRGLRKRHASTGDLPILIHTSGTGVIATPAKGMFASDLIYSDTDVAQIKSIPPTALHRNVDLTVIDADEQG
YVRTYIIVPSTIYGQAKGPLFYAGISNPISIQIPGLIRASLGRKQGGVVGLGKSIWANIHIHDVADLYIVLFDAI
TANPEGVGHGWEGFYFGENDEHTWYDVGKAISKALVDVGIGGTDGPTELTDEELTRYWGSVDAAVHVGSNSRCRA
NRGRSIGWKPIHKTADLISSIKPDVAWLWEKTQRENGIEAPISR*
Coding >RhoplFPRL280|287_8
ATGGAGGCGATCCTGCGAGGCTTGAGGAAGCGGCACGCATCGACTGGCGATCTTCCCATCCTGATCCACACCTCG
GGCACAGGCGTGATTGCCACCCCAGCCAAGGGCATGTTCGCCTCGGACTTGATCTACTCTGATACCGACGTCGCA
CAAATCAAATCCATTCCACCAACGGCGTTGCACAGAAATGTTGACCTCACTGTGATCGACGCTGACGAGCAAGGC
TATGTGCGGACCTACATCATCGTGCCGTCGACCATCTACGGCCAGGCGAAGGGCCCTCTATTCTATGCGGGTATC
TCGAACCCAATTTCGATCCAGATTCCGGGCCTCATTCGCGCATCGCTCGGCCGCAAGCAGGGCGGCGTCGTTGGC
CTAGGAAAGTCGATATGGGCCAATATTCATATCCATGACGTGGCGGACCTATACATCGTCCTTTTCGACGCGATC
ACGGCAAACCCGGAGGGCGTCGGTCATGGCTGGGAAGGCTTCTACTTCGGCGAGAACGACGAGCACACCTGGTAC
GATGTCGGCAAGGCGATCTCGAAGGCGCTGGTCGACGTCGGGATTGGCGGAACGGATGGGCCGACGGAGTTGACG
GACGAGGAACTCACGAGGTACTGGGGCTCTGTGGATGCTGCCGTTCATGTAGGCTCCAACTCGCGCTGCCGGGCG
AACCGTGGTCGGTCTATTGGTTGGAAGCCGATACATAAGACGGCAGACCTGATCTCGAGCATCAAGCCCGACGTC
GCTTGGTTGTGGGAGAAGACCCAGAGGGAGAATGGCATCGAGGCACCGATCTCGCGGTGA
Transcript >RhoplFPRL280|287_8
ATGGAGGCGATCCTGCGAGGCTTGAGGAAGCGGCACGCATCGACTGGCGATCTTCCCATCCTGATCCACACCTCG
GGCACAGGCGTGATTGCCACCCCAGCCAAGGGCATGTTCGCCTCGGACTTGATCTACTCTGATACCGACGTCGCA
CAAATCAAATCCATTCCACCAACGGCGTTGCACAGAAATGTTGACCTCACTGTGATCGACGCTGACGAGCAAGGC
TATGTGCGGACCTACATCATCGTGCCGTCGACCATCTACGGCCAGGCGAAGGGCCCTCTATTCTATGCGGGTATC
TCGAACCCAATTTCGATCCAGATTCCGGGCCTCATTCGCGCATCGCTCGGCCGCAAGCAGGGCGGCGTCGTTGGC
CTAGGAAAGTCGATATGGGCCAATATTCATATCCATGACGTGGCGGACCTATACATCGTCCTTTTCGACGCGATC
ACGGCAAACCCGGAGGGCGTCGGTCATGGCTGGGAAGGCTTCTACTTCGGCGAGAACGACGAGCACACCTGGTAC
GATGTCGGCAAGGCGATCTCGAAGGCGCTGGTCGACGTCGGGATTGGCGGAACGGATGGGCCGACGGAGTTGACG
GACGAGGAACTCACGAGGTACTGGGGCTCTGTGGATGCTGCCGTTCATGTAGGCTCCAACTCGCGCTGCCGGGCG
AACCGTGGTCGGTCTATTGGTTGGAAGCCGATACATAAGACGGCAGACCTGATCTCGAGCATCAAGCCCGACGTC
GCTTGGTTGTGGGAGAAGACCCAGAGGGAGAATGGCATCGAGGCACCGATCTCGCGGTGA
Gene >RhoplFPRL280|287_8
ATGGAGGCGATGTGAGAACGACGCCGGAAAGACCGCCGGCAGACAACATCCTCGATGGACAGGGATCAATGGTGG
ATAAGGTTACAAACCGATGGGGCTACCTACGGCGCGCGACGCCTACATAAGTCCTATTCCCACACCGGCGCACGA
CCACGTGACCCGGGCCGGCAGCGACGCTTGCCCGACATACCCAAAAGTCAACAGGCGATCCTGCGAGGCTTGAGG
AAGCGGCACGCATCGACTGGCGATCTTCCCATCCTGATCCACACCGTACGTGATCATGAGATATTTGTCCTGGCA
CTCGGCGCTTATTATGAGACTTGTAGTCGGGCACAGGCGTGATTGCCACCCCAGCCAAGGGCATGTTCGCCTCGG
ACTTGATCTACTCTGATACCGACGTCGCACAAATCAAATCCATTCCACCAACGGCGTTGCACAGAAATGTTGACC
TCACTGTGATCGACGCTGACGAGCAAGGTGCGTGCACGAGACCGTTTCCACAGCTGTGTACTCGCTCAGGCATGA
TTTCCAGGCTATGTGCGGACCTACATCATCGTGCCGTCGACCATCTACGGCCAGGCGAAGGGCCCTCTATTCTAT
GCGGGTATCTCGAACCCAATTTCGATCCAGATTCCGGGCCTCATTCGCGCATCGCTCGGCCGCAAGCAGGGCGGC
GTCGTTGGCCTAGGAAAGTCGATATGGGCCAATATTCATATCCATGACGGTAAGCTACCGGCCGCCCAGTCCTGC
GTGAGTTGACTACACGCTCTCGTAGTGGCGGACCTATACATCGTCCTTTTCGACGCGATCACGGCAAACCCGGAG
GGCGTCGGTCATGGCTGGGAAGGCTTCTACTTCGGCGAGAACGACGAGCACACCTGGTACGATGTCGGCAAGGCG
ATCTCGAAGGCGCTGGTCGACGTCGGGATTGGCGGAACGGATGGGCCGACGGAGTTGACGGACGAGGAACTCACG
AGGTACTGGGGCTCTGTGGTGAGTCTGAAAAATCTGCCGTACGTAGTACAGGCTGACTGAATGCATTATCATGCA
GGATGCTGCCGTTCATGTAGGCTCCAACTCGCGCTGCCGGGCGAACCGTGGTCGGTCTATTGGTTGGAAGCCGAT
ACATAAGACGGCAGACCTGATCTCGAGCATCAAGCCCGACGTCGCTTGGTTGTGGGAGAAGACCCAGAGGGAGAA
TGGCATCGAGGCACCGATCTCGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail