Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|283_4
Gene name
LocationNODE_283:8152..9395
Strand-
Gene length (bp)1243
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 1.6E-20 111 252

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999726

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup106
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|000340
Agaricus bisporus var bisporus H39 AgabiH39|001820
Agaricus bisporus var bisporus H39 AgabiH39|001830
Agaricus bisporus var bisporus H39 AgabiH39|063250
Agaricus bisporus var bisporus H39 AgabiH39|090410
Agaricus bisporus var bisporus H97 AgabiH97|000340
Agaricus bisporus var bisporus H97 AgabiH97|001820
Agaricus bisporus var bisporus H97 AgabiH97|001830
Agaricus bisporus var bisporus H97 AgabiH97|063250
Agaricus bisporus var bisporus H97 AgabiH97|090410
Rhodonia placenta FPRL280 RhoplFPRL280|214_10
Rhodonia placenta FPRL280 RhoplFPRL280|283_4 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|551_2
Rhodonia placenta FPRL280 RhoplFPRL280|551_3

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|283_4
MWVLLAALSLLWSVVSVVASPTPVSIAARDAITSILDPSSVLTLTSSEISAFEPYEQLARAAYCASDIVTGWQCG
EACAAIPGFEATLTGGDGDAIQLYYVGYWPSQNAVVVAHQGTDPTQLLSDLTDIDIITENLNSTLFPGVSSDVWV
HSGFADEQAQTADIILAETQSLIASKGATTVILVGHSLGGALAQLDALYMTLNLPSDIHVMSRTFGTPRVGNPAY
ADLIDSMVPDFTRMNNYLDPIPIVPGRFLGFQHPETEVHIVSDSSDDSDVVACPGNDDATDAQCTIMMVPNIVDA
DILDHLGPYPGDVYIGTIYCT*
Coding >RhoplFPRL280|283_4
ATGTGGGTCCTGCTTGCTGCGCTCTCCCTCTTGTGGAGCGTTGTGAGCGTCGTCGCGAGTCCGACACCAGTCTCT
ATAGCCGCGAGGGATGCCATCACGTCTATATTGGACCCGTCGTCCGTTCTCACTTTGACGTCGAGCGAAATCTCG
GCGTTTGAACCCTACGAGCAACTGGCAAGGGCTGCATACTGCGCGTCAGACATAGTGACAGGATGGCAATGCGGC
GAGGCATGCGCAGCCATCCCAGGCTTCGAGGCGACTTTGACGGGCGGAGACGGTGATGCTATCCAACTGTACTAC
GTTGGATACTGGCCAAGCCAGAACGCTGTAGTCGTCGCCCATCAGGGCACGGACCCAACACAACTGCTGTCCGAT
CTCACTGACATCGACATCATCACGGAGAACCTGAACAGCACACTTTTCCCGGGCGTGTCATCTGATGTCTGGGTG
CACAGCGGGTTCGCCGATGAGCAGGCCCAAACGGCAGATATAATTCTGGCCGAGACACAGAGTCTTATCGCCTCG
AAGGGCGCTACAACTGTCATCCTGGTCGGGCATTCGCTGGGAGGCGCCCTTGCTCAGCTCGACGCGCTCTATATG
ACCCTGAACCTCCCGTCGGACATCCACGTCATGTCTCGCACTTTCGGAACGCCCCGAGTGGGAAACCCAGCATAT
GCTGACCTAATCGACTCGATGGTCCCCGACTTCACTCGCATGAACAACTATCTGGACCCGATTCCGATTGTTCCC
GGGCGATTCCTGGGCTTCCAGCATCCCGAGACAGAGGTCCATATTGTGTCGGACTCGAGTGACGACTCCGATGTT
GTCGCCTGTCCCGGGAATGACGACGCAACAGACGCACAGTGTACTATCATGATGGTGCCAAACATCGTGGACGCC
GATATTCTGGACCATCTTGGGCCGTATCCTGGTGACGTCTACATTGGCACTATTTATTGCACATGA
Transcript >RhoplFPRL280|283_4
ATGTGGGTCCTGCTTGCTGCGCTCTCCCTCTTGTGGAGCGTTGTGAGCGTCGTCGCGAGTCCGACACCAGTCTCT
ATAGCCGCGAGGGATGCCATCACGTCTATATTGGACCCGTCGTCCGTTCTCACTTTGACGTCGAGCGAAATCTCG
GCGTTTGAACCCTACGAGCAACTGGCAAGGGCTGCATACTGCGCGTCAGACATAGTGACAGGATGGCAATGCGGC
GAGGCATGCGCAGCCATCCCAGGCTTCGAGGCGACTTTGACGGGCGGAGACGGTGATGCTATCCAACTGTACTAC
GTTGGATACTGGCCAAGCCAGAACGCTGTAGTCGTCGCCCATCAGGGCACGGACCCAACACAACTGCTGTCCGAT
CTCACTGACATCGACATCATCACGGAGAACCTGAACAGCACACTTTTCCCGGGCGTGTCATCTGATGTCTGGGTG
CACAGCGGGTTCGCCGATGAGCAGGCCCAAACGGCAGATATAATTCTGGCCGAGACACAGAGTCTTATCGCCTCG
AAGGGCGCTACAACTGTCATCCTGGTCGGGCATTCGCTGGGAGGCGCCCTTGCTCAGCTCGACGCGCTCTATATG
ACCCTGAACCTCCCGTCGGACATCCACGTCATGTCTCGCACTTTCGGAACGCCCCGAGTGGGAAACCCAGCATAT
GCTGACCTAATCGACTCGATGGTCCCCGACTTCACTCGCATGAACAACTATCTGGACCCGATTCCGATTGTTCCC
GGGCGATTCCTGGGCTTCCAGCATCCCGAGACAGAGGTCCATATTGTGTCGGACTCGAGTGACGACTCCGATGTT
GTCGCCTGTCCCGGGAATGACGACGCAACAGACGCACAGTGTACTATCATGATGGTGCCAAACATCGTGGACGCC
GATATTCTGGACCATCTTGGGCCGTATCCTGGTGACGTCTACATTGGCACTATTTATTGCACATGA
Gene >RhoplFPRL280|283_4
ATGTGGGTCCTGCTTGCTGCGCTCTCCCTCTTGTGGAGCGTTGTGAGCGTCGTCGCGAGTCCGACACCAGTCTCT
ATAGCCGCGAGGGATGCCATCACGTCTATATTGGACCCGTCGTCCGTTCTCACTTTGACGTCGAGCGAAATCTCG
GCGTTTGAACCCTACGAGCAACTGGCAAGGGCTGCATACTGCGCGTCAGACATAGTGACAGGATGGCAATGCGGC
GGTAAGTAGCGCAGTGATTCATATTAAATGACTGTGAAGTAATTGTGACACCCACCAGAGGCATGCGCAGCCATC
CCAGGCTTCGAGGCGACTTTGACGGGCGGAGACGGTGATGCTATCCAACTGTGTAAGTAACAACGCAGTATCAAA
ATAGAATCTCACGTCTTATATCCTCTCCAGACTACGTTGGATACTGGCCAAGCCAGAACGCTGTAGTCGTCGCCC
ATCAGGGCACGGACCCAACACAACTGTGAGTACGATCGTCTGATCGCCGTACAATGCGATATTGAATGGTGTTGC
ACTCATCAAGGCTGTCCGATCTCACTGACATCGACATCATCACGGAGAACCTGAACAGCACACTTTTCCCGGGCG
TGTCATCTGATGTCTGGGTGCACAGCGGGTTCGCCGATGAGCAGGCCCAAACGGCAGATATAATTCTGGCCGAGA
CACAGAGTCTTATCGCCTCGAAGGGCGCTACAACTGTCATCCTGGTAAGCTGTCCATTCGAGGCTGATGAACTGA
TATCTCATGTCTGATTTGTAGGTCGGGCATTCGCTGGGAGGCGCCCTTGCTCAGCTCGACGCGCTCTATATGACC
CTGAACCTCCCGTCGGACATCCACGTCATGTCTCGCACTTTCGGAACGCCCCGAGTGGGAAACCCAGCATATGCT
GACCTAATCGACTCGATGGTAATTCGCTTGCCCTACCGTCATTTACAGTGTTCGCTTACTCTTGCTCTTGCAGGT
CCCCGACTTCACTCGCATGAACAACTATCTGGACCCGATTCCGATTGTTCCCGGGCGATTCCTGGGCTTCCAGCA
TCCCGAGACAGAGGTCCATATTGTGTCGGACTCGAGTGACGACTCCGATGTTGTCGCCTGTCCCGGGAATGACGA
CGCAACAGACGCACAGTGTACTATCATGATGGTGCCAAACATCGTGGACGCCGATATTCTGGACCATCTTGGGCC
GTATCCTGGTGACGTCTACATTGGCACTATTTATTGCACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail