Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|261_10
Gene name
LocationNODE_261:13701..14398
Strand-
Gene length (bp)697
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02182 SAD_SRA SAD/SRA domain 2.2E-32 1 121

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup524
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|006800
Agaricus bisporus var bisporus H39 AgabiH39|024350
Agaricus bisporus var bisporus H97 AgabiH97|006800
Agaricus bisporus var bisporus H97 AgabiH97|024350
Rhodonia placenta FPRL280 RhoplFPRL280|159_10
Rhodonia placenta FPRL280 RhoplFPRL280|261_10 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|261_10
MDCLRAGVHRATRAGIHGSQIHGTYSIVISGGYQDDYDKGETIIYTGAGGQDVSTNERTHMQTSDQRLDHPHNAA
LVKSLEFGHRRKVRVIRGSKLGSKFAPGTMFVFYRYDGLYTVTHVSVHYIAALIHHRADLVWACSSSRGKVYMDS
TYLSSSSR*
Coding >RhoplFPRL280|261_10
ATGGACTGCCTTCGAGCAGGTGTACACAGAGCTACTCGAGCAGGTATTCATGGCAGTCAGATACATGGTACCTAT
AGTATTGTTATCAGTGGAGGTTATCAGGACGACTATGATAAGGGGGAGACTATCATCTATACCGGAGCCGGAGGC
CAGGATGTAAGTACCAATGAACGTACGCATATGCAGACGTCAGATCAGAGGCTGGATCACCCTCATAACGCCGCA
CTGGTGAAATCACTTGAGTTTGGTCATAGGAGGAAAGTCCGGGTCATCAGAGGGTCTAAATTGGGTTCAAAATTC
GCTCCTGGCACCATGTTTGTGTTCTACCGCTATGATGGGCTTTATACCGTCACACATGTAAGTGTGCATTACATT
GCTGCTCTCATACATCACAGAGCTGACCTGGTTTGGGCGTGCAGTTCGAGCAGAGGAAAGGTATACATGGATTCG
ACATATTTGTCTTCGAGCTCAAGGTGA
Transcript >RhoplFPRL280|261_10
ATGGACTGCCTTCGAGCAGGTGTACACAGAGCTACTCGAGCAGGTATTCATGGCAGTCAGATACATGGTACCTAT
AGTATTGTTATCAGTGGAGGTTATCAGGACGACTATGATAAGGGGGAGACTATCATCTATACCGGAGCCGGAGGC
CAGGATGTAAGTACCAATGAACGTACGCATATGCAGACGTCAGATCAGAGGCTGGATCACCCTCATAACGCCGCA
CTGGTGAAATCACTTGAGTTTGGTCATAGGAGGAAAGTCCGGGTCATCAGAGGGTCTAAATTGGGTTCAAAATTC
GCTCCTGGCACCATGTTTGTGTTCTACCGCTATGATGGGCTTTATACCGTCACACATGTAAGTGTGCATTACATT
GCTGCTCTCATACATCACAGAGCTGACCTGGTTTGGGCGTGCAGTTCGAGCAGAGGAAAGGTATACATGGATTCG
ACATATTTGTCTTCGAGCTCAAGGTGA
Gene >RhoplFPRL280|261_10
ATGGACTGCCTTCGAGCAGGTGTACACAGAGCTACTCGAGCAGGTATTCATGGCAGTCAGATACATGGTACCTAT
AGTATTGTTATCAGTGGAGGTTATCAGGACGACTATGATAAGGGGGAGACTATGTAAGTTATAGGTAGCCTTGAT
ATAATGTGTAGAATGATAATTAATATTTATAGCATCTATACCGGAGCCGGAGGCCAGGATGTAAGTACCAATGTC
GGATCCTAGAGGCCTCATTATAAGAACAATCAATGTCAGGAACGTACGCATATGCAGACGTCAGATCAGAGGCTG
GATCACCCTCATAACGCCGCACTGGTGGTGAGTACCGTTTTATCTCCAGTAGAACTCAAATATTAGTAATTGGTT
ACCCTAGAAATCACTTGAGTTTGGTCATAGGAGGAAAGTCCGGGTCATCAGAGGGTCTAAATTGGGTTCAAAATT
CGCTCCTGGCACCATGTTTGTGTGTTTCATGATTACAGCCCAGGGTGTCTGCGAACCGATCTCTTCTTCATGTCT
TAGCGATGGCCCTACAGTCTACCGCTATGATGGGCTTTATACCGTCACACATGTAAGTGTGCATTACATTGCTGC
TCTCATACATCACAGAGCTGACCTGGTTTGGGCGTGCAGTTCGAGCAGAGGAAAGGTATACATGGATTCGACATA
TTTGTCTTCGAGCTCAAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail