Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|25_45
Gene name
LocationNODE_25:159485..160867
Strand+
Gene length (bp)1382
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20152 DUF6534 Family of unknown function (DUF6534) 5.6E-16 83 167

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 10 29 19
2 36 58 22
3 73 95 22
4 115 137 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup19
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|004100
Agaricus bisporus var bisporus H39 AgabiH39|406100
Agaricus bisporus var bisporus H39 AgabiH39|386300
Agaricus bisporus var bisporus H39 AgabiH39|386200
Agaricus bisporus var bisporus H39 AgabiH39|102060
Agaricus bisporus var bisporus H39 AgabiH39|095970
Agaricus bisporus var bisporus H39 AgabiH39|103490
Agaricus bisporus var bisporus H39 AgabiH39|095720
Agaricus bisporus var bisporus H39 AgabiH39|022930
Agaricus bisporus var bisporus H39 AgabiH39|020260
Agaricus bisporus var bisporus H39 AgabiH39|020250
Agaricus bisporus var bisporus H39 AgabiH39|095960
Agaricus bisporus var bisporus H97 AgabiH97|096260
Agaricus bisporus var bisporus H97 AgabiH97|103490
Agaricus bisporus var bisporus H97 AgabiH97|103480
Agaricus bisporus var bisporus H97 AgabiH97|103470
Agaricus bisporus var bisporus H97 AgabiH97|102060
Agaricus bisporus var bisporus H97 AgabiH97|096250
Agaricus bisporus var bisporus H97 AgabiH97|020260
Agaricus bisporus var bisporus H97 AgabiH97|095960
Agaricus bisporus var bisporus H97 AgabiH97|095720
Agaricus bisporus var bisporus H97 AgabiH97|022930
Agaricus bisporus var bisporus H97 AgabiH97|020250
Agaricus bisporus var bisporus H97 AgabiH97|004100
Agaricus bisporus var bisporus H97 AgabiH97|095970
Rhodonia placenta FPRL280 RhoplFPRL280|25_45 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|168_9
Rhodonia placenta FPRL280 RhoplFPRL280|227_13
Rhodonia placenta FPRL280 RhoplFPRL280|435_5

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|25_45
MTPSSRVTEEALGGIIAMLVQSFFAWRILKLTRNYWLVGTVMVTALVGGLSGIGTAIGVAMLPQFAGLQRLKVIV
ILWLVGTAVCDVIITVALTWHLRSHRTGLSRTNTLISRIVRVTVSNGLLTAGFALADVIAYLATPRGIHIAFNYA
LVKLYGNSVMSSLNSRAFLSDSSGMSSSSYGKDIALNLNPDASPVGGMTRSRASRPAQVVVNVETHEMIDVGEHD
HVDKGDIEWASSTESRTQERSDDKVHVAV*
Coding >RhoplFPRL280|25_45
ATGACCCCATCATCGCGTGTTACAGAGGAAGCGTTGGGGGGCATCATCGCCATGCTGGTCCAGAGCTTTTTCGCG
TGGCGGATTCTCAAGTTAACACGGAATTACTGGCTCGTAGGCACTGTAATGGTCACAGCGCTTGTCGGCGGCCTT
TCAGGCATCGGTACGGCGATTGGGGTTGCAATGCTCCCACAGTTTGCCGGCCTGCAGCGGCTCAAGGTTATTGTC
ATTTTGTGGTTGGTGGGAACAGCGGTGTGCGACGTGATTATCACGGTGGCGCTGACTTGGCACTTGCGGAGCCAT
CGGACGGGCCTTTCCCGGACGAACACTCTGATCTCCAGAATTGTCCGCGTCACCGTGTCGAACGGCCTTTTGACA
GCAGGCTTTGCATTGGCCGATGTCATTGCATACTTAGCTACACCGCGAGGGATCCACATTGCGTTCAATTATGCC
CTGGTGAAGCTATATGGCAACTCTGTGATGTCAAGTCTGAATTCGCGCGCGTTCTTGTCGGATTCTTCGGGCATG
AGTAGTTCGTCGTACGGGAAGGACATCGCGCTCAATCTGAATCCGGACGCGTCTCCCGTTGGCGGAATGACTCGT
AGTCGAGCGTCGCGCCCCGCACAGGTTGTGGTCAACGTAGAGACCCATGAAATGATAGACGTCGGCGAACACGAC
CATGTAGACAAAGGAGACATCGAGTGGGCTTCGTCAACCGAGAGTCGAACACAGGAGCGCAGCGATGACAAGGTG
CACGTCGCAGTCTAG
Transcript >RhoplFPRL280|25_45
ATGACCCCATCATCGCGTGTTACAGAGGAAGCGTTGGGGGGCATCATCGCCATGCTGGTCCAGAGCTTTTTCGCG
TGGCGGATTCTCAAGTTAACACGGAATTACTGGCTCGTAGGCACTGTAATGGTCACAGCGCTTGTCGGCGGCCTT
TCAGGCATCGGTACGGCGATTGGGGTTGCAATGCTCCCACAGTTTGCCGGCCTGCAGCGGCTCAAGGTTATTGTC
ATTTTGTGGTTGGTGGGAACAGCGGTGTGCGACGTGATTATCACGGTGGCGCTGACTTGGCACTTGCGGAGCCAT
CGGACGGGCCTTTCCCGGACGAACACTCTGATCTCCAGAATTGTCCGCGTCACCGTGTCGAACGGCCTTTTGACA
GCAGGCTTTGCATTGGCCGATGTCATTGCATACTTAGCTACACCGCGAGGGATCCACATTGCGTTCAATTATGCC
CTGGTGAAGCTATATGGCAACTCTGTGATGTCAAGTCTGAATTCGCGCGCGTTCTTGTCGGATTCTTCGGGCATG
AGTAGTTCGTCGTACGGGAAGGACATCGCGCTCAATCTGAATCCGGACGCGTCTCCCGTTGGCGGAATGACTCGT
AGTCGAGCGTCGCGCCCCGCACAGGTTGTGGTCAACGTAGAGACCCATGAAATGATAGACGTCGGCGAACACGAC
CATGTAGACAAAGGAGACATCGAGTGGGCTTCGTCAACCGAGAGTCGAACACAGGAGCGCAGCGATGACAAGGTG
CACGTCGCAGTCTAG
Gene >RhoplFPRL280|25_45
ATGACCCCATCATCGCGTGTTACAGAGGAAGCGTTGGGGGTGAGTTCGGCTCTGCGGTCTTCCGCACAGGAACAG
GAGGATAAAATGACCCCAATTGCAGGGCATCATCGCCATGCTGGTCCAGAGCTTTTTCGCGTGGCGGATTCTCAA
GTTAACACGGAATTACTGGCTCGTAGGCACTGTAATGGTCACAGCGCTTGTCGGCGGCCGTACGTGCAGTCTCGC
TCTTCTCCCTCGGCCATCCACTTACGTGGCTCCCTCCGTCTCCAGTTTCAGGCATCGGTACGGCGATTGGGGTTG
CAATGCTCCCACAGTTTGCCGGCCTGCAGCGGCTCAAGGTACGCGCCGTTTCTATCTCTGTCATTGCATAACTAT
ACGGACGTCATCATGGCCGCGTATTACCGCGTAGGTTATTGTCATTTTGTGGTTGGTGGGAACAGCGGTGTGCGA
CGTGATTATCACGGTGGCGCTGACTTGGCACTTGGTATGTCCCACCCGGACAACATACACCTGGGGGATTCACTA
CCATCTCACAATGCCATCTTTCTCCGTAGCGGAGCCATCGGACGGGCCTTTCCCGGACGAACACTCTGATCTCCA
GAATTGTCCGCGGTGGGTTGTTGACGGTCTCCTCCTGCGAGCTAGTTCACTGACGACGTATTACCGTGTGCAGTC
ACCGTGTCGAACGGCCTTTTGACAGCAGGCTTTGCATTGGCCGATGTCATTGCATACTTAGCTACAGTATGTATC
TACTGACCTATTTCCGGTGTATTTCTGACCTGATCTCCACGTCTGCGGCGCAAGCCGCGAGGGATCCACATTGGT
AGGTCTGTTTCTAGGCGGCGTATTATTTTGCTCTGACCGACACATTTCATACAAGCGTTCAATTATGCCCTGGTG
AAGCTGTACGTTTGAATTCGCTTGCAGCCTTCTTGGTATCACAAATGACGAGTAACTGTAGATATGGCAACTCTG
TGATGTCAAGTCTGAATTCGCGCGCGTTCTTGTCGGATTCTTCGGGCATGAGTAGTTCGTCGTACGGGAAGGACA
TCGCGCTCAATCTGGTGCGTGATAACATGCATCTCATTGGAGACCTTCCGTAATCTGCCTATCCAGAATCCGGAC
GCGTCTCCCGTTGGCGGAATGACTCGTAGTCGAGCGTCGCGCCCCGCACAGGTACGCATGTATAAAGAGCCGGCC
CCGAACCCCCACTGAGCCCTGCCGTAAAACTCCTATTTCAGGTTGTGGTCAACGTAGAGACCCATGAAATGATAG
ACGTCGGCGAACACGACCATGTAGACAAAGGAGACATCGAGTGGGCTTCGTCAACCGAGAGTCGAACACAGGAGC
GCAGCGATGACAAGGTGCACGTCGCAGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail