Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|259_8
Gene name
LocationNODE_259:25623..26787
Strand+
Gene length (bp)1164
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 1.9E-09 9 217

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup5616
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|024700
Agaricus bisporus var bisporus H97 AgabiH97|024700
Rhodonia placenta FPRL280 RhoplFPRL280|259_8 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|259_8
MVPSTKQIYNDQGFIIVRDLIPVDSRKSLEEAADRAIARTRSGSWKLRRTVGRQFPPYGDDDPDSWGVQHVMHPE
LREPAFAQWYTSDPLVNVVKELLGCQEDELQMELFNMLINPESHAFALRWHRDDVRESAADDEEWTALGIWHHGV
QIYRALYTDSCLYVVPGSHKVPRTPAQRAHSSTLDPPTNPMDMPGAIQVTLQPGETVFYNNNILHCATYDPKQRR
ATLHASMGDTRGGATRARNVLQHGLMWMKEAHFRESLNERGRVMLDRLITLQESIEGDVGYSLAN*
Coding >RhoplFPRL280|259_8
ATGGTCCCTTCAACCAAACAGATATACAACGACCAGGGCTTCATCATTGTGCGCGACCTCATCCCCGTAGACTCT
CGTAAGTCTCTCGAAGAGGCTGCTGACCGCGCGATTGCACGAACGCGCTCGGGCAGTTGGAAGCTGAGGCGTACG
GTAGGACGCCAGTTTCCCCCGTATGGCGACGATGACCCGGACTCGTGGGGCGTGCAGCACGTCATGCACCCCGAG
CTGCGCGAGCCTGCCTTCGCGCAGTGGTACACGTCCGACCCCCTCGTGAACGTCGTGAAAGAGCTCCTCGGATGT
CAGGAGGACGAGCTGCAGATGGAGCTGTTCAACATGCTGATCAATCCCGAGTCGCATGCGTTTGCCTTGCGCTGG
CACCGCGATGATGTGCGTGAGAGCGCCGCCGACGACGAAGAGTGGACCGCCCTGGGCATCTGGCATCATGGCGTG
CAAATATATAGGGCCCTCTATACGGATTCGTGTCTCTATGTTGTGCCCGGGTCTCACAAGGTCCCCCGCACTCCG
GCGCAGCGCGCACACTCGTCCACGCTTGACCCTCCTACGAACCCCATGGACATGCCCGGGGCGATCCAGGTGACC
CTGCAACCCGGAGAGACGGTCTTTTACAACAACAACATCCTGCACTGCGCGACGTACGACCCAAAGCAGCGTCGC
GCCACTCTTCACGCGTCTATGGGCGATACACGTGGCGGAGCGACTCGTGCTCGGAATGTCCTGCAGCACGGGCTG
ATGTGGATGAAGGAGGCACACTTCCGCGAGAGTCTGAACGAACGCGGCAGAGTGATGCTCGACCGACTCATCACG
CTGCAGGAGAGCATTGAGGGAGATGTGGGCTATTCTCTCGCCAACTGA
Transcript >RhoplFPRL280|259_8
ATGGTCCCTTCAACCAAACAGATATACAACGACCAGGGCTTCATCATTGTGCGCGACCTCATCCCCGTAGACTCT
CGTAAGTCTCTCGAAGAGGCTGCTGACCGCGCGATTGCACGAACGCGCTCGGGCAGTTGGAAGCTGAGGCGTACG
GTAGGACGCCAGTTTCCCCCGTATGGCGACGATGACCCGGACTCGTGGGGCGTGCAGCACGTCATGCACCCCGAG
CTGCGCGAGCCTGCCTTCGCGCAGTGGTACACGTCCGACCCCCTCGTGAACGTCGTGAAAGAGCTCCTCGGATGT
CAGGAGGACGAGCTGCAGATGGAGCTGTTCAACATGCTGATCAATCCCGAGTCGCATGCGTTTGCCTTGCGCTGG
CACCGCGATGATGTGCGTGAGAGCGCCGCCGACGACGAAGAGTGGACCGCCCTGGGCATCTGGCATCATGGCGTG
CAAATATATAGGGCCCTCTATACGGATTCGTGTCTCTATGTTGTGCCCGGGTCTCACAAGGTCCCCCGCACTCCG
GCGCAGCGCGCACACTCGTCCACGCTTGACCCTCCTACGAACCCCATGGACATGCCCGGGGCGATCCAGGTGACC
CTGCAACCCGGAGAGACGGTCTTTTACAACAACAACATCCTGCACTGCGCGACGTACGACCCAAAGCAGCGTCGC
GCCACTCTTCACGCGTCTATGGGCGATACACGTGGCGGAGCGACTCGTGCTCGGAATGTCCTGCAGCACGGGCTG
ATGTGGATGAAGGAGGCACACTTCCGCGAGAGTCTGAACGAACGCGGCAGAGTGATGCTCGACCGACTCATCACG
CTGCAGGAGAGCATTGAGGGAGATGTGGGCTATTCTCTCGCCAACTGA
Gene >RhoplFPRL280|259_8
ATGGTCCCTTCAACCAAACAGATATACAACGACCAGGGCTTCATCATTGTGCGCGACCTCATCCCCGTAGACTCT
CGTAAGTCTCTCGAAGAGGCTGCTGACCGCGCGATTGCACGAACGCGCTCGGGCAGTTGGAAGCTGAGGCGTACG
GTGAGCTCTTTTTCTGTTCTTTGCAGTGAGCGAGAACAGCCTAACAGGCCGTCCGGCGACCGCAGGTAGGACGCC
AGTTTCCCCCGTATGGCGACGATGACCCGGACTCGTGGGGCGTGCAGCACGTCATGCACCCCGAGCTGCGCGAGC
CTGCCTTCGCGCAGTGGTACACGTCCGACCCCCTCGTGAACGTCGTGAAAGAGCTCCTCGGATGTCAGGAGGACG
AGCTGCAGATGGGTGCGCCGCGCTGCGCTGCATTGCCCGCGTGATTCCGCATGCAATCTGACGGGCCCAGAGCTG
TTCAACATGCTGATCAATCCCGAGTCGCATGCGTTTGCCTTGCGCTGGCACCGCGATGATGTGCGTGAGAGCGCC
GCCGACGACGAAGAGTGGACCGCCCTGGGCATCTGGCATCATGGCGTGCGTGCTTTGCTCCAGTCTCCGCTCCAA
TGCAGAAACGACTGAACAGATGTTGCGCGTATCTAGGTGCAATGGAACACGTTTGTCTCCTACCCTTCCTCTTAT
CTGCCGTAAGCCCATCGGAAATATATAGGGCCCTCTATACGGATTCGTGTCTCTATGTTGTGCCCGGGTCTCACA
AGGTCCCCCGCACTCCGGCGCAGCGCGCACACTCGTCCACGCTTGACCCTCCTACGAACCCCATGGACATGCCCG
GGGCGATCCAGGTGACCCTGCAACGTATGTTCGGAATCTCTCAGCGCCGCTTCTTTCTAGCTTACTGCTACAGCC
GGAGAGACGGTCTTTTACAACAACAACATCCTGCACTGCGCGACGTACGACCCAAAGCAGCGTCGCGCCACTCTT
CACGCGTCTATGGGCGATACACGTGGCGGAGCGACTCGTGCTCGGAATGTCCTGCAGCACGGGCTGATGTGGATG
AAGGAGGCACACTTCCGCGAGAGTCTGAACGAACGCGGCAGAGTGATGCTCGACCGACTCATCACGCTGCAGGAG
AGCATTGAGGGAGATGTGGGCTATTCTCTCGCCAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail