Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|258_1
Gene name
LocationNODE_258:8577..11186
Strand+
Gene length (bp)2609
Transcript length (bp)2334
Coding sequence length (bp)2334
Protein length (aa) 778

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 6.7E-14 212 313
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 5.9E-22 493 601

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999724

Transmembrane Domains

Domain # Start End Length
1 657 679 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA5_1 1.8E-211 24 621

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1124
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|031980
Agaricus bisporus var bisporus H39 AgabiH39|031990
Agaricus bisporus var bisporus H97 AgabiH97|031980
Agaricus bisporus var bisporus H97 AgabiH97|031990
Rhodonia placenta FPRL280 RhoplFPRL280|258_1 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|258_1
MISRQLSLLALTMAAAAPTTLAQTHSPGSIENAGDTLVSAMMMFLGTEEIVYILDKAEGNAAQVDGHPAWGSAYN
IAGRTAQTMEVVTNTFCASGMHLPNGSYATFGGNGAVSPGGNIGDVLAPGGYSASYDTTYHDYSGSTSIRILNPC
AWSDLSNTECQWFDNATLLHMQKQRWYSAAEPLGDGSIAIIGGFVEGGYINRNYPNVDPATEGGAAEPTYEFYPS
KGPAQTMQFLIQTSGLNAYAHTYMMPSGKMFVQANVSTMLWDPLTNEETALPPMPDNIVRVYPGSGAAAMLPLTP
ANNYTPTVMFCGGSDMPDYAWGNYSWPFINTFYYPASAKCHQITPEPVDGSAPQYVEVDSMPDTRTMGQFIHLPN
GKMLVVNGGKNGTAGYSKMTLETPELSQMPYGESLAAGPVGKPAIFDPTAASGSHWSNDGFDTSNIARLYHSSAI
LLPDASVLIAGSNPNLDVNTSAFFPTQYQAEVFYPPYFSASTRPTPQNVPTTLSYGGDAFDVLVPSSSYSGDANS
AAENTSVWLIRPGWTTHGMNMGQRSMQLNNTFTVNQNGSISLHVAQLPPNPNLFQPGPGLLFVTMSGIPSNGTMV
LIGSGEIGTQPTAAVSTLPPSVRLNNVSGSGSGSANSTSTASGSAASESSSASHTGAIVGGIVAAVAVVGILGAA
FGVYMARRRRTAAQQNPGSMYAMSSAPGAGGAMASRNLRDSDSSAFVPLQQDNKSTWDATANASNVSLSPYHDDM
RSAGPSGEFDPYYQNAPRQSTSQRPRY*
Coding >RhoplFPRL280|258_1
ATGATTTCCCGCCAGCTGTCGCTGCTGGCTCTCACTATGGCGGCGGCCGCGCCTACAACACTCGCGCAGACACAT
TCCCCTGGGTCGATCGAAAATGCTGGCGACACGCTTGTCAGTGCTATGATGATGTTTTTGGGGACCGAGGAGATT
GTGTACATTCTCGACAAGGCAGAAGGCAACGCGGCGCAGGTCGACGGACACCCCGCATGGGGTTCGGCATACAAC
ATCGCCGGCCGGACGGCGCAGACGATGGAGGTGGTCACCAACACGTTCTGTGCGTCAGGCATGCATTTGCCTAAT
GGCTCCTACGCCACGTTTGGCGGTAACGGTGCGGTGTCACCGGGTGGTAACATCGGCGATGTACTGGCGCCCGGC
GGGTATTCCGCCAGCTACGATACGACCTACCACGACTACTCTGGCTCAACTTCCATCCGTATCCTGAACCCGTGT
GCCTGGTCGGACCTGTCAAACACCGAATGCCAATGGTTCGACAACGCGACGCTGCTTCACATGCAGAAGCAGCGA
TGGTACTCGGCCGCGGAGCCCCTCGGAGACGGCTCGATCGCAATCATTGGCGGTTTCGTGGAAGGTGGTTACATC
AACAGAAACTACCCGAATGTCGACCCGGCAACCGAGGGTGGTGCGGCTGAGCCCACATACGAATTCTATCCTAGC
AAAGGCCCGGCGCAAACGATGCAGTTCTTGATCCAGACATCTGGTCTGAACGCGTACGCACACACGTACATGATG
CCATCCGGCAAGATGTTTGTGCAGGCCAACGTCTCGACTATGCTCTGGGACCCACTAACAAACGAGGAAACAGCA
CTACCACCCATGCCAGACAACATTGTTCGTGTCTACCCAGGGTCTGGTGCCGCGGCTATGCTCCCCTTGACGCCC
GCCAACAACTACACGCCCACAGTGATGTTCTGTGGTGGTTCTGACATGCCTGACTATGCGTGGGGCAACTACTCA
TGGCCGTTCATCAACACGTTCTACTACCCAGCATCCGCTAAATGCCACCAGATCACGCCAGAGCCGGTTGACGGT
TCCGCGCCTCAATACGTCGAGGTTGACAGCATGCCCGACACCCGCACCATGGGGCAGTTCATCCACCTCCCCAAC
GGCAAGATGTTGGTTGTGAACGGCGGCAAGAACGGGACTGCCGGATACTCGAAGATGACCCTGGAGACTCCCGAG
CTCTCGCAGATGCCGTATGGAGAATCTCTTGCTGCCGGCCCGGTTGGGAAGCCCGCGATCTTTGACCCCACAGCG
GCCAGCGGCTCGCATTGGTCTAACGATGGCTTCGACACCTCTAACATTGCTCGTCTCTACCACTCTTCGGCCATC
CTGCTCCCAGATGCGTCTGTTCTCATTGCGGGCTCCAACCCCAACCTCGATGTCAACACCAGCGCCTTCTTCCCT
ACCCAGTACCAGGCTGAAGTGTTCTACCCGCCCTACTTCTCTGCATCCACTCGTCCCACTCCCCAGAACGTTCCG
ACGACCTTGTCCTACGGTGGAGATGCTTTCGACGTCCTCGTCCCGTCCTCTTCGTACTCGGGCGATGCGAACAGC
GCGGCTGAAAACACCAGTGTCTGGCTCATTCGCCCCGGCTGGACCACGCACGGGATGAACATGGGACAGCGGTCT
ATGCAGCTGAACAACACCTTCACCGTGAACCAGAATGGCTCAATATCTCTTCACGTTGCTCAGCTCCCGCCCAAC
CCGAACTTGTTCCAGCCTGGCCCGGGCTTGTTGTTTGTCACGATGTCTGGCATTCCCAGCAACGGTACGATGGTC
TTGATTGGCAGCGGAGAGATTGGCACGCAGCCAACTGCTGCCGTCTCCACTCTGCCTCCGAGCGTCCGCTTGAAC
AACGTGTCGGGATCAGGCTCCGGCTCCGCCAACTCAACCTCGACCGCTAGCGGCAGCGCTGCGTCGGAATCAAGC
AGCGCATCCCACACGGGAGCGATCGTCGGAGGCATTGTCGCTGCCGTCGCAGTCGTTGGAATCCTTGGTGCGGCT
TTCGGTGTTTATATGGCCCGACGGAGACGCACCGCCGCGCAGCAGAACCCGGGGTCGATGTACGCCATGTCCTCG
GCGCCCGGCGCGGGCGGTGCTATGGCCAGTCGTAACTTGCGCGATTCTGACTCGAGTGCGTTTGTGCCCCTGCAG
CAGGATAATAAGAGCACGTGGGACGCGACGGCGAACGCGAGCAACGTCAGCCTGTCGCCGTACCACGACGACATG
CGCTCGGCGGGGCCGAGTGGCGAGTTCGACCCTTACTACCAGAACGCGCCTCGTCAGAGCACGTCGCAGCGGCCT
CGGTATTGA
Transcript >RhoplFPRL280|258_1
ATGATTTCCCGCCAGCTGTCGCTGCTGGCTCTCACTATGGCGGCGGCCGCGCCTACAACACTCGCGCAGACACAT
TCCCCTGGGTCGATCGAAAATGCTGGCGACACGCTTGTCAGTGCTATGATGATGTTTTTGGGGACCGAGGAGATT
GTGTACATTCTCGACAAGGCAGAAGGCAACGCGGCGCAGGTCGACGGACACCCCGCATGGGGTTCGGCATACAAC
ATCGCCGGCCGGACGGCGCAGACGATGGAGGTGGTCACCAACACGTTCTGTGCGTCAGGCATGCATTTGCCTAAT
GGCTCCTACGCCACGTTTGGCGGTAACGGTGCGGTGTCACCGGGTGGTAACATCGGCGATGTACTGGCGCCCGGC
GGGTATTCCGCCAGCTACGATACGACCTACCACGACTACTCTGGCTCAACTTCCATCCGTATCCTGAACCCGTGT
GCCTGGTCGGACCTGTCAAACACCGAATGCCAATGGTTCGACAACGCGACGCTGCTTCACATGCAGAAGCAGCGA
TGGTACTCGGCCGCGGAGCCCCTCGGAGACGGCTCGATCGCAATCATTGGCGGTTTCGTGGAAGGTGGTTACATC
AACAGAAACTACCCGAATGTCGACCCGGCAACCGAGGGTGGTGCGGCTGAGCCCACATACGAATTCTATCCTAGC
AAAGGCCCGGCGCAAACGATGCAGTTCTTGATCCAGACATCTGGTCTGAACGCGTACGCACACACGTACATGATG
CCATCCGGCAAGATGTTTGTGCAGGCCAACGTCTCGACTATGCTCTGGGACCCACTAACAAACGAGGAAACAGCA
CTACCACCCATGCCAGACAACATTGTTCGTGTCTACCCAGGGTCTGGTGCCGCGGCTATGCTCCCCTTGACGCCC
GCCAACAACTACACGCCCACAGTGATGTTCTGTGGTGGTTCTGACATGCCTGACTATGCGTGGGGCAACTACTCA
TGGCCGTTCATCAACACGTTCTACTACCCAGCATCCGCTAAATGCCACCAGATCACGCCAGAGCCGGTTGACGGT
TCCGCGCCTCAATACGTCGAGGTTGACAGCATGCCCGACACCCGCACCATGGGGCAGTTCATCCACCTCCCCAAC
GGCAAGATGTTGGTTGTGAACGGCGGCAAGAACGGGACTGCCGGATACTCGAAGATGACCCTGGAGACTCCCGAG
CTCTCGCAGATGCCGTATGGAGAATCTCTTGCTGCCGGCCCGGTTGGGAAGCCCGCGATCTTTGACCCCACAGCG
GCCAGCGGCTCGCATTGGTCTAACGATGGCTTCGACACCTCTAACATTGCTCGTCTCTACCACTCTTCGGCCATC
CTGCTCCCAGATGCGTCTGTTCTCATTGCGGGCTCCAACCCCAACCTCGATGTCAACACCAGCGCCTTCTTCCCT
ACCCAGTACCAGGCTGAAGTGTTCTACCCGCCCTACTTCTCTGCATCCACTCGTCCCACTCCCCAGAACGTTCCG
ACGACCTTGTCCTACGGTGGAGATGCTTTCGACGTCCTCGTCCCGTCCTCTTCGTACTCGGGCGATGCGAACAGC
GCGGCTGAAAACACCAGTGTCTGGCTCATTCGCCCCGGCTGGACCACGCACGGGATGAACATGGGACAGCGGTCT
ATGCAGCTGAACAACACCTTCACCGTGAACCAGAATGGCTCAATATCTCTTCACGTTGCTCAGCTCCCGCCCAAC
CCGAACTTGTTCCAGCCTGGCCCGGGCTTGTTGTTTGTCACGATGTCTGGCATTCCCAGCAACGGTACGATGGTC
TTGATTGGCAGCGGAGAGATTGGCACGCAGCCAACTGCTGCCGTCTCCACTCTGCCTCCGAGCGTCCGCTTGAAC
AACGTGTCGGGATCAGGCTCCGGCTCCGCCAACTCAACCTCGACCGCTAGCGGCAGCGCTGCGTCGGAATCAAGC
AGCGCATCCCACACGGGAGCGATCGTCGGAGGCATTGTCGCTGCCGTCGCAGTCGTTGGAATCCTTGGTGCGGCT
TTCGGTGTTTATATGGCCCGACGGAGACGCACCGCCGCGCAGCAGAACCCGGGGTCGATGTACGCCATGTCCTCG
GCGCCCGGCGCGGGCGGTGCTATGGCCAGTCGTAACTTGCGCGATTCTGACTCGAGTGCGTTTGTGCCCCTGCAG
CAGGATAATAAGAGCACGTGGGACGCGACGGCGAACGCGAGCAACGTCAGCCTGTCGCCGTACCACGACGACATG
CGCTCGGCGGGGCCGAGTGGCGAGTTCGACCCTTACTACCAGAACGCGCCTCGTCAGAGCACGTCGCAGCGGCCT
CGGTATTGA
Gene >RhoplFPRL280|258_1
ATGATTTCCCGCCAGCTGTCGCTGCTGGCTCTCACTATGGCGGCGGCCGCGCCTACAACACTCGCGCAGACACAT
TCCCCTGGGTCGATCGAAAATGCTGGCGACACGCTTGTCAGTGCTATGATGGTAAGTCTGCATGTTTTCGCTCGC
CAATGTGCGATGTAGCGCCGGGGGTCGCGCAGGAAAACTTGTCGGTCTCGGAGGGGTGGTTGGTCTCTTTCTGGC
TCACCGTTGTCCCCTGTCTCGCCTCCGATGCATTTCACGCGACCACTTTTTAGCGCCGCGGCCGTTCGCCGTCTC
ACGCGGCGTCTTTTCTCCGTCGTTACCACCGCTTATTCCGCGCCGTAGATGTTTTTGGGGACCGAGGAGATTGTG
TACATTCTCGACAAGGCAGAAGGCAACGCGGCGCAGGTCGACGGACACCCCGCATGGGGTTCGGCATACAACATC
GCCGGCCGGACGGCGCAGACGATGGAGGTGGTCACCAACACGTTCTGTGCGTCAGGCATGCATTTGCCTAATGGC
TCCTACGCCACGTTTGGCGGTAACGGTGCGGTGTCACCGGGTGGTAACATCGGCGATGTACTGGCGCCCGGCGGG
TATTCCGCCAGCTACGATACGACCTACCACGACTACTCTGGCTCAACTTCCATCCGTATCCTGAACCCGTGTGCC
TGGTCGGACCTGTCAAACACCGAATGCCAATGGTTCGACAACGCGACGCTGCTTCACATGCAGAAGCAGCGATGG
TACTCGGCCGCGGAGCCCCTCGGAGACGGCTCGATCGCAATCATTGGCGGTTTCGTGGAAGGTGGTTACATCAAC
AGAAACTACCCGAATGTCGACCCGGCAACCGAGGGTGGTGCGGCTGAGCCCACATACGAATTCTATCCTAGCAAA
GGCCCGGCGCAAACGATGCAGTTCTTGATCCAGACATCTGGTCTGAACGCGTACGCACACACGTACATGATGCCA
TCCGGCAAGATGTTTGTGCAGGCCAACGTCTCGACTAGTAAGCCTTCGTAAATTTGTTATTTCACCGTGCTCACA
ACGCTGTTCCGCTAGTGCTCTGGGACCCACTAACAAACGAGGAAACAGCACTACCACCCATGCCAGACAACATTG
TTCGTGTCTACCCAGGGTCTGGTGCCGCGGCTATGCTCCCCTTGACGCCCGCCAACAACTACACGCCCACAGTGA
TGTTCTGTGGTGGTTCTGACATGCCTGACTATGCGTGGGGCAACTACTCATGGCCGTTCATCAACACGTTCTACT
ACCCAGCATCCGCTAAATGCCACCAGATCACGCCAGAGCCGGTTGACGGTTCCGCGCCTCAATACGTCGAGGTTG
ACAGCATGCCCGACACCCGCACCATGGGGCAGTTCATCCACCTCCCCAACGGCAAGATGTTGGTTGTGAACGGCG
GCAAGAACGGGACTGCCGGATACTCGAAGATGACCCTGGAGACTCCCGAGCTCTCGCAGATGCCGTATGGAGAAT
CTCTTGCTGCCGGCCCGGTTGGGAAGCCCGCGATCTTTGACCCCACAGCGGCCAGCGGCTCGCATTGGTCTAACG
ATGGCTTCGACACCTCTAACATTGCTCGTCTCTACCACTCTTCGGCCATCCTGCTCCCAGATGCGTCTGTTCTCA
TTGCGGGCTCCAACCCCAACCTCGATGTCAACACCAGCGCCTTCTTCCCTACCCAGTACCAGGCTGAAGTGTTCT
ACCCGCCCTACTTCTCTGCATCCACTCGTCCCACTCCCCAGAACGTTCCGACGACCTTGTCCTACGGTGGAGATG
CTTTCGACGTCCTCGTCCCGTCCTCTTCGTACTCGGGCGATGCGAACAGCGCGGCTGAAAACACCAGTGTCTGGC
TCATTCGCCCCGGCTGGACCACGCACGGGATGAACATGGGACAGCGGTCTATGCAGCTGAACAACACCTTCACCG
TGAACCAGAATGGCTCAATATCTCTTCACGTTGCTCAGCTCCCGCCCAACCCGAACTTGTTCCAGCCTGGCCCGG
GCTTGTTGTTTGTCACGATGTCTGGCATTCCCAGCAACGGTACGATGGTCTTGATTGGCAGCGGAGAGATTGGCA
CGCAGCCAACTGCTGCCGTCTCCACTCTGCCTCCGAGCGTCCGCTTGAACAACGTGTCGGGATCAGGCTCCGGCT
CCGCCAACTCAACCTCGACCGCTAGCGGCAGCGCTGCGTCGGAATCAAGCAGCGCATCCCACACGGGAGCGATCG
TCGGAGGCATTGTCGCTGCCGTCGCAGTCGTTGGAATCCTTGGTGCGGCTTTCGGTGTTTATATGGCCCGACGGA
GACGCACCGCCGCGCAGCAGAACCCGGGGTCGATGTACGCCATGTCCTCGGCGCCCGGCGCGGGCGGTGCTATGG
CCAGTCGTAACTTGCGCGATTCTGACTCGAGTGCGTTTGTGCCCCTGCAGCAGGATAATAAGAGCACGTGGGACG
CGACGGCGAACGCGAGCAACGTCAGCCTGTCGCCGTACCACGACGACATGCGCTCGGCGGGGCCGAGTGGCGAGT
TCGACCCTTACTACCAGAACGCGCCTCGTCAGAGCACGTCGCAGCGGCCTCGGTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail