Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|20_12
Gene name
LocationNODE_20:86745..88883
Strand+
Gene length (bp)2138
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 1.9E-28 59 328

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 313 335 22
2 468 490 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup2884
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|370300
Agaricus bisporus var bisporus H97 AgabiH97|089560
Rhodonia placenta FPRL280 RhoplFPRL280|20_12 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|20_12
MGAMSMLVLLLTHPLEFRTLIQYKLWHESNRDITAPSEHAHSGWNRVPMRRCWGLLDLTSRSFAGVIRELDGDLA
RVICLFYLVLRALDTIEDDMTLSDDKKQPLLRAFHEYAVKPGWTFTENGPDEKDRQLLVEYDVVAEEINLLDARY
RDVIIDITLKMETGMADYAHRAATTGEVYVEKSAEYDLYCHYVAGLVGEGLTRIWAASGKEAPWLGTQLVLANSM
GLMLQKTNIIRDYREDIEQRRFFWPREIWGRAVYGKAVGRAAFTAMEQMCQPGNEQQALWVQSAMVVDVLSHAVD
ALDYLRLLKQQSVFNFCAIPQTMAIATLCLCFMNYEMFQRNIKIRKAEAASLIMRSTNPRDVAYIFRDYARKIHS
KAVPGDPSFLQISVACGKIEQWCEHYYPSFVSVSKSASGNAQQVFDPTDARTQIVQLAEKRDRQLAIEKRMGNGA
AKEAARPLGESPSDTREILLYVGAAFVVIFLIGIGAAWLLMQFFE*
Coding >RhoplFPRL280|20_12
ATGGGCGCCATGTCAATGCTTGTCTTGCTGCTCACGCACCCCCTTGAGTTCCGGACGCTCATCCAGTACAAGCTC
TGGCACGAAAGCAATCGCGACATCACAGCACCGAGCGAGCATGCACACTCAGGATGGAATCGTGTGCCCATGCGA
AGATGCTGGGGACTCCTGGACCTGACGAGCAGGAGCTTTGCGGGCGTCATCAGGGAGTTAGACGGCGACTTGGCA
AGAGTGATCTGCTTGTTCTACCTGGTACTACGGGCATTGGACACAATCGAAGATGACATGACCCTATCAGACGAC
AAAAAGCAGCCACTGCTGCGCGCCTTCCACGAGTACGCGGTCAAGCCAGGCTGGACGTTCACCGAGAACGGCCCG
GATGAAAAGGACCGGCAGCTGCTCGTCGAGTACGACGTCGTCGCAGAGGAAATAAACCTCCTGGATGCGCGATAT
CGCGACGTCATCATCGACATCACGCTGAAGATGGAGACCGGGATGGCGGACTACGCGCACCGCGCGGCGACGACA
GGCGAGGTGTACGTCGAGAAGAGCGCCGAGTACGACCTCTACTGCCACTACGTCGCGGGGCTCGTCGGCGAGGGC
CTCACGCGGATATGGGCCGCGTCGGGCAAGGAGGCGCCGTGGCTCGGCACGCAGCTCGTGCTCGCGAACTCGATG
GGCCTCATGCTGCAGAAGACCAATATCATCCGCGACTACCGCGAGGACATCGAGCAGCGCCGCTTCTTCTGGCCG
CGCGAGATCTGGGGCCGCGCGGTGTACGGCAAGGCCGTCGGGCGCGCCGCGTTCACCGCGATGGAGCAGATGTGC
CAGCCCGGCAACGAGCAGCAGGCGCTGTGGGTGCAGAGCGCGATGGTCGTCGACGTGCTCTCGCACGCCGTCGAC
GCGCTCGACTACCTCCGCCTGCTCAAGCAGCAGAGCGTGTTCAACTTCTGCGCGATCCCGCAGACCATGGCGATC
GCGACGCTCTGCCTGTGCTTCATGAACTACGAGATGTTCCAGCGGAACATCAAGATCCGCAAGGCGGAGGCTGCT
TCGCTGATCATGCGGTCAACGAACCCGCGGGACGTGGCCTACATCTTCCGCGACTACGCGCGAAAAATCCACAGC
AAGGCCGTGCCAGGCGACCCGAGCTTCCTGCAGATCTCTGTGGCGTGTGGAAAGATTGAGCAGTGGTGCGAGCAC
TACTACCCATCGTTCGTCAGCGTATCAAAATCGGCGTCGGGCAACGCGCAGCAAGTGTTCGATCCCACGGACGCA
CGAACGCAGATTGTCCAGCTCGCGGAGAAGCGGGATCGCCAGCTCGCTATCGAGAAGCGAATGGGCAACGGGGCC
GCCAAGGAGGCCGCTCGGCCACTCGGCGAATCTCCAAGCGACACTCGGGAGATCCTGCTCTACGTGGGCGCCGCA
TTCGTTGTTATTTTCTTGATCGGGATCGGCGCGGCGTGGTTGCTCATGCAGTTTTTCGAGTAG
Transcript >RhoplFPRL280|20_12
ATGGGCGCCATGTCAATGCTTGTCTTGCTGCTCACGCACCCCCTTGAGTTCCGGACGCTCATCCAGTACAAGCTC
TGGCACGAAAGCAATCGCGACATCACAGCACCGAGCGAGCATGCACACTCAGGATGGAATCGTGTGCCCATGCGA
AGATGCTGGGGACTCCTGGACCTGACGAGCAGGAGCTTTGCGGGCGTCATCAGGGAGTTAGACGGCGACTTGGCA
AGAGTGATCTGCTTGTTCTACCTGGTACTACGGGCATTGGACACAATCGAAGATGACATGACCCTATCAGACGAC
AAAAAGCAGCCACTGCTGCGCGCCTTCCACGAGTACGCGGTCAAGCCAGGCTGGACGTTCACCGAGAACGGCCCG
GATGAAAAGGACCGGCAGCTGCTCGTCGAGTACGACGTCGTCGCAGAGGAAATAAACCTCCTGGATGCGCGATAT
CGCGACGTCATCATCGACATCACGCTGAAGATGGAGACCGGGATGGCGGACTACGCGCACCGCGCGGCGACGACA
GGCGAGGTGTACGTCGAGAAGAGCGCCGAGTACGACCTCTACTGCCACTACGTCGCGGGGCTCGTCGGCGAGGGC
CTCACGCGGATATGGGCCGCGTCGGGCAAGGAGGCGCCGTGGCTCGGCACGCAGCTCGTGCTCGCGAACTCGATG
GGCCTCATGCTGCAGAAGACCAATATCATCCGCGACTACCGCGAGGACATCGAGCAGCGCCGCTTCTTCTGGCCG
CGCGAGATCTGGGGCCGCGCGGTGTACGGCAAGGCCGTCGGGCGCGCCGCGTTCACCGCGATGGAGCAGATGTGC
CAGCCCGGCAACGAGCAGCAGGCGCTGTGGGTGCAGAGCGCGATGGTCGTCGACGTGCTCTCGCACGCCGTCGAC
GCGCTCGACTACCTCCGCCTGCTCAAGCAGCAGAGCGTGTTCAACTTCTGCGCGATCCCGCAGACCATGGCGATC
GCGACGCTCTGCCTGTGCTTCATGAACTACGAGATGTTCCAGCGGAACATCAAGATCCGCAAGGCGGAGGCTGCT
TCGCTGATCATGCGGTCAACGAACCCGCGGGACGTGGCCTACATCTTCCGCGACTACGCGCGAAAAATCCACAGC
AAGGCCGTGCCAGGCGACCCGAGCTTCCTGCAGATCTCTGTGGCGTGTGGAAAGATTGAGCAGTGGTGCGAGCAC
TACTACCCATCGTTCGTCAGCGTATCAAAATCGGCGTCGGGCAACGCGCAGCAAGTGTTCGATCCCACGGACGCA
CGAACGCAGATTGTCCAGCTCGCGGAGAAGCGGGATCGCCAGCTCGCTATCGAGAAGCGAATGGGCAACGGGGCC
GCCAAGGAGGCCGCTCGGCCACTCGGCGAATCTCCAAGCGACACTCGGGAGATCCTGCTCTACGTGGGCGCCGCA
TTCGTTGTTATTTTCTTGATCGGGATCGGCGCGGCGTGGTTGCTCATGCAGTTTTTCGAGTAG
Gene >RhoplFPRL280|20_12
ATGGGCGCCATGTCAATGCTTGTCTTGCTGCTCACGCACCCCCTTGAGTTCCGGACGCTCATCCAGTACAAGCTC
TGGCACGAAAGCAATCGCGACATCACAGCACCGAGCGAGCATGCACACTCAGGATGGAATCGTGTGCCCATGCGA
AGATGCTGGGGACTCCTGGACCTGACGAGCAGGAGCTTTGCGGGCGTCATCAGGGAGTTAGACGGCGACTTGGCA
AGAGTGGTGAGTGAACGAGTGTTTTTGCATTTCTCGCGCGCAGCGCGATCATCCTACTTGCACTATGGCTTGAAC
AGTTGAGCCCTATCTGCCTTTGCTTCAAGTTGCCACCATCTCATGTAGGGCACGGAGGCGCAACCCCGGCGCCGC
GCCCGCTGTCTGATGTTCCGTAGAAGGCTTCCATCTGTCTTCACCTTTATGGGCATATGCCTCGCAAGGCATTCC
AGGAGCGCGTTTGTGGGGGTTTTCCGTTACATATTCTGGTCATACTTTCTGTTTGACCATTGAGTGTAACTGCAC
TGGCATGAGTGTTCAAGATGATCACCCGCCTTTTTGTGAGGGTACCAGAGGGCGCACACTTCGAAGCACTCTCAG
AAGGCTGTTTGCAGACTCACACGCCCGAGGACAAGACGTGGTCCCCTTTGCCATGCACGCGGTTATGACATAAGG
AAGGGAACATGCTGACCATGAGCATTTCTAGATCTGCTTGTTCTACCTGGTACTACGGGCATTGGACACAATCGA
AGATGACATGACCCTATCAGACGACAAAAAGCAGCCACTGCTGCGCGCCTTCCACGAGTACGCGGTCAAGCCAGG
CTGGACGTTCACCGAGAACGGCCCGGATGAAAAGGACCGGCAGCTGCTCGTCGAGTACGACGTCGTCGCAGAGGA
AATAAACCTCCTGGATGCGCGGTAAGCTTCCCGTCCCATCTGTCATACCGCCGCCCCTCGGCTGACGTCTCAACA
TATAGATATCGCGACGTCATCATCGACATCACGCTGAAGATGGAGACCGGGATGGCGGACTACGCGCACCGCGCG
GCGACGACAGGCGAGGTGTACGTCGAGAAGAGCGCCGAGTACGACCTCTACTGCCACTACGTCGCGGGGCTCGTC
GGCGAGGGCCTCACGCGGATATGGGCCGCGTCGGGCAAGGAGGCGCCGTGGCTCGGCACGCAGCTCGTGCTCGCG
AACTCGATGGGCCTCATGCTGCAGAAGACCAATATCATCCGCGACTACCGCGAGGACATCGAGCAGCGCCGCTTC
TTCTGGCCGCGCGAGATCTGGGGCCGCGCGGTGTACGGCAAGGCCGTCGGGCGCGCCGCGTTCACCGCGATGGAG
CAGATGTGCCAGCCCGGCAACGAGCAGCAGGCGCTGTGGGTGCAGAGCGCGATGGTCGTCGACGTGCTCTCGCAC
GCCGTCGACGCGCTCGACTACCTCCGCCTGCTCAAGCAGCAGAGCGTGTTCAACTTCTGCGCGATCCCGCAGACC
ATGGCGATCGCGACGCTCTGCCTGTGCTTCATGAACTACGAGATGTTCCAGCGGAACATCAAGATCCGCAAGGCG
GAGGCTGCTTCGGTGCGCATTCACCTCTCCTAGACTGGAATTTTCGATTGCTAGCGTTCCCGCAGCTGATCATGC
GGTCAACGAACCCGCGGGACGTGGCCTACATCTTCCGCGACTACGCGCGAAAAATCCACAGCAAGGCCGTGCCAG
GCGACCCGAGCTTCCTGCAGATCTCTGTGGCGTGTGGAAAGGTGCGGCGGTCTCGCGTCTCTGCTCCCGGCATGT
GTTGGATTAACACCGCACGTTACCCGCAGATTGAGCAGTGGTGCGAGCACTACTACCCATCGTTCGTCAGCGTAT
CAAAATCGGCGTCGGGCAACGCGCAGCAAGTGTTCGATCCCACGGACGCACGAACGCAGATTGTCCAGCTCGCGG
AGAAGCGGGATCGCCAGCTCGCTATCGAGAAGCGAATGGGCAACGGGGCCGCCAAGGAGGCCGCTCGGCCACTCG
GCGAATCTCCAAGCGACACTCGGGAGATCCTGCTCTACGTGGGCGCCGCATTCGTTGTTATTTTCTTGATCGGGA
TCGGCGCGGCGTGGTTGCTCATGCAGTTTTTCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail