Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|1_80
Gene name
LocationNODE_1:271358..275524
Strand-
Gene length (bp)4166
Transcript length (bp)2958
Coding sequence length (bp)2958
Protein length (aa) 986

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 727 749 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup920
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|010250
Agaricus bisporus var bisporus H39 AgabiH39|010260
Agaricus bisporus var bisporus H39 AgabiH39|010270
Agaricus bisporus var bisporus H97 AgabiH97|010250
Agaricus bisporus var bisporus H97 AgabiH97|010260
Agaricus bisporus var bisporus H97 AgabiH97|010270
Rhodonia placenta FPRL280 RhoplFPRL280|1_80 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|1_80
MQSERSKVPARSGDAPMPTSGKIPSASGIISLHEKPGSRPQPLCQRTGAANSPKVKSALRASVKPVVSEGLLDVK
RHSSAPLLLPPVKQAVRTIVPAGNIQDSPRRKISMASSVHGSSRAPSTVNSPAKVTPVQRLPAVPATKYALSSVS
AARQLPPLCGAARSHTKPDNRGAAPELCLTPTAMLRTSARAALSGTYVNNGSDMQKKESARCTASLESRPVDPSY
TSGTKPVRHSAVSATPLQATVQTASSGTPTPRAVKALPSSRILNHMKNGSFRPILPTPFLILLGARASLGNPEGR
IRAVVMRHGTIVRNVSFTEPRIRLPRLFKVRRGHCNVAPFLKASESVPAFVPMPPVASRRASPRSVLKPTRLLGV
DKANPYAMVRPETYYGRPQLGTVEDLSRSPFIDRSNVTCVDVEAQILAVDVGGASTDDIKSTFTAPLRSGDISID
GESPLESLEDRTEAVHASKIGDMHDRPPAHIDQVYAAGNFTFDYGDATQCDDFSVSWSGGTAPYQLTLIPVFYGR
TLNYTIPSSSYSNGQGSYKVQLPFPENQTVIAIMSDANGFATGGVSDVITTGPSISHSQCNVTAQAVDFFFDTDM
ALNQCREYSFSNYTGAIQPATITGIIPGGETFVLNPPTGPPDFEWIANIKASTSILFLMIDSKGRQGGSTPIDQV
GVTNDATCLTGSYPSSLAVHPSATFTSSSASATSTSTTSGSSSKSSVSGGAIAGGVIGGIVGLAAIALLAYFFLR
RNRRTRGRFYDDGVYQAYRAGRSKKQDVDLVHETSEDAPPAVVQPYPLFNPSEFGDGSDLGAVSSVSNLMQPGPH
PGYMPYPHSTHSRQMSDGTSAFPESMPGLRDSFSSSSNAQSISSGAQRKAAMAGLTAYQPPARFILHTDAEDVIE
LPPQYSAFRAPSTTVQSGDEASTSGAEVLPPPPPFESGVSTTMPGRSAGMLEQDDETSQARLQQPLSPGPPTALP
SPTSHNFSSR*
Coding >RhoplFPRL280|1_80
ATGCAAAGCGAACGAAGCAAAGTACCGGCCAGATCTGGTGATGCGCCTATGCCCACTTCTGGCAAGATCCCGTCG
GCCTCTGGAATTATCTCTCTGCACGAGAAACCGGGCTCTCGTCCACAGCCGTTATGTCAACGAACCGGCGCCGCT
AACTCTCCTAAGGTCAAGAGCGCGCTACGAGCATCTGTTAAGCCTGTGGTTTCTGAAGGCCTCTTGGACGTAAAG
AGGCATTCTTCTGCTCCTTTGCTCTTGCCACCTGTCAAGCAGGCAGTGCGTACAATTGTGCCGGCGGGGAATATT
CAGGACAGTCCGCGACGCAAGATTTCTATGGCGTCTAGTGTACATGGCTCGTCTCGTGCACCTTCTACAGTTAAC
AGCCCAGCCAAAGTGACCCCAGTGCAGCGATTGCCTGCTGTACCTGCAACAAAGTATGCCTTGTCTTCCGTATCC
GCTGCGCGTCAACTGCCGCCATTGTGTGGTGCCGCTAGATCCCACACCAAGCCAGACAACAGAGGCGCTGCGCCA
GAATTGTGTCTTACCCCTACAGCCATGCTCAGGACCTCTGCACGGGCGGCCTTGTCAGGGACTTATGTCAACAAT
GGGTCTGACATGCAGAAGAAAGAATCTGCTAGGTGTACTGCCTCCTTGGAATCAAGGCCCGTCGACCCTTCCTAC
ACCTCGGGCACGAAACCTGTTCGGCACTCGGCTGTCTCGGCAACGCCTTTACAAGCAACTGTCCAAACGGCGTCA
TCTGGGACTCCCACGCCTAGAGCTGTCAAAGCTTTACCCTCAAGCAGGATTCTGAATCACATGAAAAACGGTTCC
TTTCGGCCCATCCTCCCCACGCCGTTTCTCATCCTCTTGGGCGCGCGCGCCTCGCTGGGGAACCCGGAGGGACGC
ATTCGAGCAGTAGTCATGCGCCATGGCACGATCGTGCGCAACGTGTCATTCACTGAGCCTAGGATTCGTCTGCCG
AGGCTTTTTAAAGTTCGTCGAGGTCATTGCAATGTTGCGCCTTTCTTGAAGGCCTCCGAGTCGGTTCCCGCTTTT
GTTCCTATGCCTCCAGTCGCCAGCCGCCGTGCTTCGCCGCGCTCGGTGCTGAAACCGACCCGGTTGCTGGGGGTA
GACAAGGCCAACCCATACGCTATGGTACGGCCCGAAACTTACTACGGTCGGCCGCAACTCGGCACTGTCGAGGAC
TTGTCGCGTAGTCCCTTCATTGACAGATCTAACGTCACTTGTGTGGACGTAGAAGCACAAATTTTGGCTGTGGAC
GTCGGCGGGGCAAGCACGGACGATATCAAGTCTACCTTCACGGCCCCGCTCCGTTCGGGTGACATTTCAATTGAT
GGGGAGAGTCCTCTGGAGTCCCTGGAGGATCGTACTGAGGCTGTTCACGCCAGCAAGATCGGTGATATGCACGAC
CGCCCCCCGGCGCATATTGATCAAGTCTATGCCGCCGGCAACTTCACTTTCGACTACGGGGATGCTACGCAATGC
GACGACTTCAGTGTGTCATGGTCAGGCGGAACTGCACCGTATCAACTCACACTCATTCCTGTGTTCTACGGACGA
ACGCTGAATTACACCATCCCGTCCTCTAGCTATAGCAATGGACAGGGCTCATACAAAGTCCAGCTACCGTTCCCG
GAAAATCAGACCGTCATTGCAATCATGTCGGACGCGAACGGCTTTGCTACAGGAGGAGTCTCCGATGTCATTACG
ACGGGACCGTCTATCAGTCATTCTCAGTGTAACGTCACTGCGCAAGCCGTTGACTTCTTCTTCGACACTGATATG
GCCTTGAATCAGTGCAGAGAGTACTCATTCTCCAACTACACGGGGGCCATACAACCGGCCACCATTACAGGCATC
ATTCCTGGTGGCGAGACATTTGTGCTCAATCCGCCTACCGGTCCCCCTGACTTTGAGTGGATAGCGAATATCAAG
GCTTCCACGTCGATTCTGTTCTTAATGATAGATTCGAAGGGTCGCCAGGGAGGGAGTACCCCTATTGACCAGGTC
GGAGTGACCAATGACGCCACATGTCTCACCGGCTCCTACCCGTCCTCACTTGCTGTACATCCATCTGCCACATTT
ACGAGTTCATCAGCAAGCGCAACCTCGACCTCTACCACATCAGGTAGTTCTTCCAAATCATCGGTCTCCGGGGGC
GCTATCGCAGGAGGCGTGATAGGCGGCATAGTGGGACTCGCTGCTATCGCGCTTCTGGCCTACTTCTTTTTACGA
AGAAATAGGCGCACCAGAGGCAGGTTCTACGACGACGGCGTTTACCAGGCATATCGCGCAGGGCGTAGTAAGAAA
CAGGATGTCGACTTGGTCCACGAGACTAGCGAGGACGCACCACCTGCGGTCGTCCAGCCGTATCCCCTCTTCAAC
CCAAGTGAATTCGGAGACGGCAGCGACCTTGGTGCTGTCTCGTCTGTATCGAACCTCATGCAACCAGGTCCCCAT
CCTGGCTATATGCCATATCCCCACTCGACGCACTCGCGACAGATGTCGGACGGCACATCTGCATTCCCAGAATCC
ATGCCTGGCTTGCGAGACAGCTTTTCGTCCTCGTCAAATGCGCAAAGCATCTCCTCAGGCGCACAGCGGAAAGCA
GCGATGGCGGGCTTGACTGCCTACCAGCCTCCTGCCCGTTTCATTCTCCACACCGACGCGGAAGACGTGATTGAG
CTGCCTCCGCAGTACAGCGCGTTCCGCGCGCCGTCTACGACTGTGCAGTCGGGGGACGAGGCTTCTACATCTGGT
GCTGAGGTGCTACCACCACCCCCGCCTTTTGAGAGCGGGGTCTCCACAACAATGCCGGGACGTTCAGCAGGCATG
TTAGAACAGGACGACGAGACTTCTCAAGCCCGTCTGCAGCAACCGTTGTCTCCGGGGCCGCCAACAGCCCTTCCT
TCACCAACCTCTCACAACTTTTCGTCACGATGA
Transcript >RhoplFPRL280|1_80
ATGCAAAGCGAACGAAGCAAAGTACCGGCCAGATCTGGTGATGCGCCTATGCCCACTTCTGGCAAGATCCCGTCG
GCCTCTGGAATTATCTCTCTGCACGAGAAACCGGGCTCTCGTCCACAGCCGTTATGTCAACGAACCGGCGCCGCT
AACTCTCCTAAGGTCAAGAGCGCGCTACGAGCATCTGTTAAGCCTGTGGTTTCTGAAGGCCTCTTGGACGTAAAG
AGGCATTCTTCTGCTCCTTTGCTCTTGCCACCTGTCAAGCAGGCAGTGCGTACAATTGTGCCGGCGGGGAATATT
CAGGACAGTCCGCGACGCAAGATTTCTATGGCGTCTAGTGTACATGGCTCGTCTCGTGCACCTTCTACAGTTAAC
AGCCCAGCCAAAGTGACCCCAGTGCAGCGATTGCCTGCTGTACCTGCAACAAAGTATGCCTTGTCTTCCGTATCC
GCTGCGCGTCAACTGCCGCCATTGTGTGGTGCCGCTAGATCCCACACCAAGCCAGACAACAGAGGCGCTGCGCCA
GAATTGTGTCTTACCCCTACAGCCATGCTCAGGACCTCTGCACGGGCGGCCTTGTCAGGGACTTATGTCAACAAT
GGGTCTGACATGCAGAAGAAAGAATCTGCTAGGTGTACTGCCTCCTTGGAATCAAGGCCCGTCGACCCTTCCTAC
ACCTCGGGCACGAAACCTGTTCGGCACTCGGCTGTCTCGGCAACGCCTTTACAAGCAACTGTCCAAACGGCGTCA
TCTGGGACTCCCACGCCTAGAGCTGTCAAAGCTTTACCCTCAAGCAGGATTCTGAATCACATGAAAAACGGTTCC
TTTCGGCCCATCCTCCCCACGCCGTTTCTCATCCTCTTGGGCGCGCGCGCCTCGCTGGGGAACCCGGAGGGACGC
ATTCGAGCAGTAGTCATGCGCCATGGCACGATCGTGCGCAACGTGTCATTCACTGAGCCTAGGATTCGTCTGCCG
AGGCTTTTTAAAGTTCGTCGAGGTCATTGCAATGTTGCGCCTTTCTTGAAGGCCTCCGAGTCGGTTCCCGCTTTT
GTTCCTATGCCTCCAGTCGCCAGCCGCCGTGCTTCGCCGCGCTCGGTGCTGAAACCGACCCGGTTGCTGGGGGTA
GACAAGGCCAACCCATACGCTATGGTACGGCCCGAAACTTACTACGGTCGGCCGCAACTCGGCACTGTCGAGGAC
TTGTCGCGTAGTCCCTTCATTGACAGATCTAACGTCACTTGTGTGGACGTAGAAGCACAAATTTTGGCTGTGGAC
GTCGGCGGGGCAAGCACGGACGATATCAAGTCTACCTTCACGGCCCCGCTCCGTTCGGGTGACATTTCAATTGAT
GGGGAGAGTCCTCTGGAGTCCCTGGAGGATCGTACTGAGGCTGTTCACGCCAGCAAGATCGGTGATATGCACGAC
CGCCCCCCGGCGCATATTGATCAAGTCTATGCCGCCGGCAACTTCACTTTCGACTACGGGGATGCTACGCAATGC
GACGACTTCAGTGTGTCATGGTCAGGCGGAACTGCACCGTATCAACTCACACTCATTCCTGTGTTCTACGGACGA
ACGCTGAATTACACCATCCCGTCCTCTAGCTATAGCAATGGACAGGGCTCATACAAAGTCCAGCTACCGTTCCCG
GAAAATCAGACCGTCATTGCAATCATGTCGGACGCGAACGGCTTTGCTACAGGAGGAGTCTCCGATGTCATTACG
ACGGGACCGTCTATCAGTCATTCTCAGTGTAACGTCACTGCGCAAGCCGTTGACTTCTTCTTCGACACTGATATG
GCCTTGAATCAGTGCAGAGAGTACTCATTCTCCAACTACACGGGGGCCATACAACCGGCCACCATTACAGGCATC
ATTCCTGGTGGCGAGACATTTGTGCTCAATCCGCCTACCGGTCCCCCTGACTTTGAGTGGATAGCGAATATCAAG
GCTTCCACGTCGATTCTGTTCTTAATGATAGATTCGAAGGGTCGCCAGGGAGGGAGTACCCCTATTGACCAGGTC
GGAGTGACCAATGACGCCACATGTCTCACCGGCTCCTACCCGTCCTCACTTGCTGTACATCCATCTGCCACATTT
ACGAGTTCATCAGCAAGCGCAACCTCGACCTCTACCACATCAGGTAGTTCTTCCAAATCATCGGTCTCCGGGGGC
GCTATCGCAGGAGGCGTGATAGGCGGCATAGTGGGACTCGCTGCTATCGCGCTTCTGGCCTACTTCTTTTTACGA
AGAAATAGGCGCACCAGAGGCAGGTTCTACGACGACGGCGTTTACCAGGCATATCGCGCAGGGCGTAGTAAGAAA
CAGGATGTCGACTTGGTCCACGAGACTAGCGAGGACGCACCACCTGCGGTCGTCCAGCCGTATCCCCTCTTCAAC
CCAAGTGAATTCGGAGACGGCAGCGACCTTGGTGCTGTCTCGTCTGTATCGAACCTCATGCAACCAGGTCCCCAT
CCTGGCTATATGCCATATCCCCACTCGACGCACTCGCGACAGATGTCGGACGGCACATCTGCATTCCCAGAATCC
ATGCCTGGCTTGCGAGACAGCTTTTCGTCCTCGTCAAATGCGCAAAGCATCTCCTCAGGCGCACAGCGGAAAGCA
GCGATGGCGGGCTTGACTGCCTACCAGCCTCCTGCCCGTTTCATTCTCCACACCGACGCGGAAGACGTGATTGAG
CTGCCTCCGCAGTACAGCGCGTTCCGCGCGCCGTCTACGACTGTGCAGTCGGGGGACGAGGCTTCTACATCTGGT
GCTGAGGTGCTACCACCACCCCCGCCTTTTGAGAGCGGGGTCTCCACAACAATGCCGGGACGTTCAGCAGGCATG
TTAGAACAGGACGACGAGACTTCTCAAGCCCGTCTGCAGCAACCGTTGTCTCCGGGGCCGCCAACAGCCCTTCCT
TCACCAACCTCTCACAACTTTTCGTCACGATGA
Gene >RhoplFPRL280|1_80
ATGCAAAGCGAACGAAGCAAAGTCTGCCGGACACTTCTCTCTCCTCTGGCTTCTGCGCCTAGGTCACCTCGACCA
CCTGTGCCTATCTTGCTGCGTGATGTGACGAACACTCGCTCTGGTGCTACTGCTGGACAGGTACCGGCCAGATCT
GGTGATGCGCCTATGCCCACTTCTGGCAAGATCCCGCTAGCTATGCGAGCTAGTTGCGCTCGACCTATCTCTAGG
TCGGCCTCTGGAATTATCTCTCTGCACGAGAAACCGGGCTCTCGTCCACAGCCGTTATGTCAACGAACCGGCGCC
GCTAACTCTCCTAAGGTCAAGAGCGCGCTACGAGCATCTGTTAAGCCTGTGGTTTCTGAAGGCCTCTTGGACGTA
AAGAGGCATTCTTCTGCTCCTTTGCTCTTGCCACCTGTCAAGCAGGCAGTGCGTACAATTGTGCCGGCGGGGAAT
ATTCAGGACAGTCCGCGACGCAAGATTTCTATGGCGTCTAGTGTACATGGCTCGTCTCGTGCACCTTCTACAGTT
AACAGCCCAGCCAAAGTGACCCCAGTGCAGCGATTGCCTGCTGTACCTGCAACAAAGTATGCCTTGTCTTCCGTA
TCCGCTGCGCGTCAACTGCCGCCATTGTGTGGTGCCGCTAGATCCCACACCAAGCCAGACAACAGAGGCGCTGCG
CCAGAATTGTGTCTTACCCCTACAGCCATGCTCAGGACCTCTGCACGGGCGGCCTTGTCAGGGACTTATGTCAAC
AATGGGTCTGACATGCAGAAGAAAGAATCTGCTAGGTGTACTGCCTCCTTGGAATCAAGGCCCGTCGACCCTTCC
TACACCTCGGGCACGAAACCTGTTCGGCACTCGGCTGTCTCGGGCACGAGTGAGAAGTATCGAGGCGTCAGCTCT
GGCGCCACTACGTCTGGTGGCACCCCGTCAACTAGACGCAGCTGCGATACCTCGGACAATTTGACTCCTCGTGGC
GCGTCGAGACGTATTCGGTCTTGCTCTGGATCTGGGTGTGCTGCTGCGTCACCTGTCAAGACTCCTTCTGCGCGG
TCTTCTAGTCCTGCACTGATCTCTGTGACTAGAAGTCGTGATGCTCGTTGTCCAGCAACGCCTTTACAAGCAACT
GTCCAAACGGCGTCATCTGGGACTCCCACGCCTAGAGCTGTCAAAGCTTTACCCTCAAGCAGGATTCTGAATCAC
ATGAAAAACGGTTCCTTTCGGCCCATCCTCCCCACGCCGTTTCTCATCCTCTTGGGCGCGCGCGCCTCGCTGGGG
AACCCGGAGGGACGCATTCGAGCAGTAGTCATGCGCCATGGCACGATCGTGCGCAACGTGTCATTCACTGAGCCT
AGGATTCGTCTGCCGAGGCTTTTTAAAGTTCGTCGAGGTCATTGCAATGTTGCGCCTTTCTTGAAGGCCTCCGAG
TCGGTTCCCGCTTTTGTTCCTATGCCTCCAGTCGCCAGCCGCCGTGCTTCGCCGCGCTCGGTGCTGAAACCGACC
CGGTTGCTGGGGGTAGACAAGGCCAACCCATACGCTATGGTACGGCCCGAAACTTACTACGGTCGGCCGCAACTC
GGCACTGTCGAGGACTTGTCGCGTAGTCCCTTCATTGACAGATCTAACGTCACTTGTGTGGACGTAGAAGCACAA
ATTTTGGCTGTGGACGTCGGCGGGGCAAGCACGGACGATATCAAGTCTACCTTCACGGCCCCGCTCGTGCGTCGA
CGCCGAATGGACCTGAAGGCACTGTTTCCAGTGCACAGCGTTCGGGTGACATTTCAATTGATGGGGAGAGTCCTC
TGGAGTCCCTGGAGGATCGTACTGAGGCTGTTCACGCCAGCAAGGTAAATATAACCGTTGTTATGGTGCCTCGTG
ATCGTTTGTTCGGGATTGACCACATCGCTACCACACGAACTTCATCTTGTTTCTGGATTTGTTGCGCCTCGATAT
GTACGGTTCACGATGTGTTTGGTCCGCGTCCAGATTCATGTAGGGCAGATTGGGAGGAGGGATTGCTGAAGCAAT
ATTATGTTATACCATCTTCCAGCACGCTTTCGAGGGCACTTTTGGACTCAGCGATATTAGCGTGCCTGGGTGGCA
CCGGCAGATCGGTGATATGCACGACCGCCCCCCGGCGCATATTGATCAAGTTGCAATTGGTCCTACCCGCTGCCT
TCCTGCGCATCTCCCTCACCCTCTTCTACCAACACCGCTCCGGAGCAGTCTGTCTGTCTCACCTTACGCATCGGC
GTAGCCTGGTCGCTCGTGCCTCTTGAGCCCCCCCGTTACAACTTCTTGTCTTGCGGTTCGTTATTTTATGCTTTC
GGTCATGCAGACGCGCCTGGGCTATCTGTCGGCCATAATACTCCTGTGTGCGTCTCAGGTCTATGCCGCCGGCAA
CTTCACTTTCGACTACGGGGATGCTACGCAATGCGACGACTTCAGTGTGTCATGGTCAGGTGCGCCAAGATACTA
GCTCGTCATGCGAGTATTCACTCAAAGCCAACTTGCAGGCGGAACTGCACCGTATCAACTCACACTCATTCCTGT
GCGTGCTTGCATCGAAGCAAACTCATGTGCTGTGTCAATTGACCAAACATGTAGGTGTTCTACGGACGAACGCTG
AATTACACCATCCCGTCCTCTAGCTATAGCAATGGACAGGGCTCATACAAAGTCCAGCTACCGTTCCCGGAAAAT
CAGACCGTCATTGCAATCATGTCGGACGCGAACGGCTTTGCTACAGGAGGAGTCTCCGATGTCATTACGACGGGA
CCGTCTATCAGTCATTCTCAGTGTAACGTCACTGCGCAAGGTCGCCTCTCTCGCCGCATCTATATCTGGTGTATT
CGCTAACCTACATGCCGATAGCCGTTGACTTCTTCTTCGACACTGATATGGCCTTGAATCAGTGCAGGTAAGTAT
CTCAATGTTAGTGAATCAGAAGACCCAGGCTCATGATGCTGCCGGTAGAGAGTACTCATTCTCCAACTACACGGG
GGCCATACAACCGGCCACCATTACAGTATGCGTTTTCCTTTCTTATTTGTTCACATGCACTAACTACTATCGTAC
AGGGCATCATTCCTGGTGGCGAGACATTTGTGCTCAATCCGCCTACCGGTCCCCCTGACTTTGAGTGGATAGCGA
ATATCAAGGCTTCCACGTCGATTCTGTTCTTAATGATAGATTCGAAGGGTCGCCAGGGAGGGAGTACCCCTATTG
ACCAGGTCGGAGTGACCAATGACGCCACATGTCTCACCGGCTCCTACCCGTCCTCACTTGCTGTACATCCATCTG
CCACATTTACGAGTTCATCAGCAAGCGCAACCTCGACCTCTACCACATCAGGTAGTTCTTCCAAATCATCGGTCT
CCGGGGGCGCTATCGCAGGAGGCGTGATAGGCGGCATAGTGGGACTCGCTGCTATCGCGCTTCTGGCCTACTTCT
TTTTACGAAGAAATAGGCGCACCAGAGGCAGGTTCTACGACGACGGCGTTTACCAGGCATATCGCGCAGGGCGTA
GTAAGAAACAGGATGTCGACTTGGTCCACGAGACTAGCGAGGACGCACCACCTGCGGTCGTCCAGCCGTATCCCC
TCTTCAACCCAAGTGAATTCGGAGACGGCAGCGACCTTGGTGCTGTCTCGTCTGTATCGAACCTCATGCAACCAG
GTCCCCATCCTGGCTATATGCCATATCCCCACTCGACGCACTCGCGACAGATGTCGGACGGCACATCTGCATTCC
CAGAATCCATGCCTGGCTTGCGAGACAGCTTTTCGTCCTCGTCAAATGCGCAAAGCATCTCCTCAGGCGCACAGC
GGAAAGCAGCGATGGCGGGCTTGACTGCCTACCAGCCTCCTGCCCGTTTCATTCTCCACACCGACGCGGAAGACG
TGATTGAGCTGCCTCCGCAGTACAGCGCGTTCCGCGCGCCGTCTACGACTGTGCAGTCGGGGGACGAGGCTTCTA
CATCTGGTGCTGAGGTGCTACCACCACCCCCGCCTTTTGAGAGCGGGGTCTCCACAACAATGCCGGGACGTTCAG
CAGGCATGTTAGAACAGGACGACGAGACTTCTCAAGCCCGTCTGCAGCAACCGTTGTCTCCGGGGCCGCCAACAG
CCCTTCCTTCACCAACCTCTCACAACTTTTCGTCACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail