Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|19_7
Gene name
LocationNODE_19:26612..29122
Strand+
Gene length (bp)2510
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06418 CTP_synth_N CTP synthase N-terminus 2.5E-122 3 273
PF00117 GATase Glutamine amidotransferase class-I 7.7E-49 318 556

GO

GO Term Description Terminal node
GO:0006221 pyrimidine nucleotide biosynthetic process Yes
GO:0003883 CTP synthase activity Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0008152 metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0003674 molecular_function No
GO:0044281 small molecule metabolic process No
GO:0072528 pyrimidine-containing compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006220 pyrimidine nucleotide metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0072527 pyrimidine-containing compound metabolic process No
GO:0008150 biological_process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0016874 ligase activity No
GO:0006796 phosphate-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|19_7
MTKYILVSGGVVSGIGKGVIASSTGLLLKTAGLKVTAIKIDPYMNIDAGTMRPQEHGEVYVLNDGGEVDLDLGNY
ERYLDVTLSRDNNITTGKIYREVIEKERRGDYLGKTVQIVPHVTNAIQDWIERVSKVPVDETGEEPDVCIVELGG
TVGDIESAPFVEAMRQFQFRVGYENFALIHVSLVPDMHGEQKTKPTQTTVHALRGLGLLPDLIACRLVVQKPLEP
ATKSKISMFCHVAPEQVIGVHDVSSVYHVPLLLQSQGIVEYLHKRLNLASIKLTSEMQERGSCLGVRWKELTKRQ
ERVFDDVTIALVGKYTDLQDSYMSVTKSLEHSAFRCNRRLILKWVDSSHLEPETQTSDPAKYHDAWRAVVAAGGI
LVPGGFGERGSEGMMLAIKWAREQKVPFLGICFGFQLAVVEWARNVCGLTGATSGEFHPDAKHPIIIFMPEISTT
HMGGTMRLGLRPTVFEPETETRSKVRKLYGGAGKIWERHRHRYEVNPAYIEKLTASGMSFIGKDERGERMQVLEV
PDHPYFVGFQAHPEFCTRPLNPSPPFLGFVAASSGQTVLNEQLEHQLTHFHPPHPEGSMVSEAELRRTETPPPGV
EKVLRSE*
Coding >RhoplFPRL280|19_7
ATGACCAAGTACATTCTCGTCTCCGGCGGTGTCGTCAGTGGCATTGGGAAGGGGGTAATTGCCTCTTCGACAGGC
TTGCTCCTGAAGACGGCTGGTCTGAAGGTGACCGCCATCAAGATTGATCCGTACATGAATATAGATGCAGGAACC
ATGCGCCCGCAAGAGCATGGTGAGGTCTATGTCCTGAACGACGGCGGAGAAGTCGATCTCGACCTCGGAAATTAT
GAACGCTATCTGGACGTTACTCTGTCCCGAGACAACAACATCACGACAGGAAAAATCTATCGCGAGGTTATTGAG
AAAGAGCGGAGAGGAGATTATCTAGGGAAAACGGTCCAGATTGTGCCTCATGTCACTAATGCTATTCAAGATTGG
ATTGAGCGAGTGTCAAAAGTTCCTGTTGACGAGACAGGAGAAGAGCCTGATGTTTGCATTGTCGAGCTAGGAGGC
ACAGTAGGTGACATCGAGTCGGCACCGTTCGTCGAGGCGATGCGACAGTTCCAATTCCGCGTGGGATATGAGAAC
TTCGCGCTTATCCATGTATCACTCGTCCCGGATATGCACGGCGAGCAAAAAACAAAACCAACGCAGACTACAGTC
CATGCTCTGCGAGGACTTGGTCTCCTCCCCGACCTGATCGCTTGCCGACTGGTCGTCCAAAAGCCCCTTGAGCCG
GCAACGAAGTCAAAAATCTCCATGTTTTGTCATGTTGCGCCTGAGCAAGTCATCGGCGTGCATGACGTCTCGTCC
GTCTATCACGTTCCCCTCCTATTGCAGTCGCAGGGCATTGTAGAATACCTCCACAAGCGTCTGAATCTCGCGAGC
ATCAAATTGACATCGGAGATGCAGGAGCGCGGCTCTTGTCTTGGGGTGAGATGGAAAGAGCTGACCAAACGACAA
GAGCGGGTGTTTGATGACGTGACAATTGCGCTGGTTGGGAAGTACACTGACCTCCAGGACTCTTATATGTCTGTC
ACTAAGTCACTGGAGCATTCTGCATTCCGCTGCAACCGGCGACTGATCCTGAAGTGGGTCGACTCGTCACATTTG
GAGCCTGAAACACAGACCTCAGATCCGGCCAAGTATCACGACGCGTGGAGAGCTGTCGTTGCTGCGGGTGGCATC
CTCGTTCCAGGGGGCTTTGGCGAGCGAGGATCAGAGGGCATGATGTTGGCAATCAAGTGGGCTCGCGAGCAGAAA
GTTCCCTTCTTGGGTATATGCTTCGGGTTCCAGCTGGCAGTCGTGGAGTGGGCGCGGAATGTCTGCGGCCTGACA
GGAGCCACCTCCGGCGAGTTCCACCCCGATGCAAAGCATCCGATTATCATTTTCATGCCTGAGATCTCAACAACG
CATATGGGGGGGACGATGCGTCTTGGCCTGCGTCCGACCGTCTTCGAGCCTGAGACAGAGACCCGTTCGAAGGTG
CGGAAACTCTATGGCGGCGCGGGCAAAATTTGGGAGCGGCATAGACACCGCTATGAAGTCAACCCGGCATACATC
GAAAAGCTCACTGCGAGCGGGATGTCCTTCATCGGCAAGGACGAGAGGGGGGAGCGGATGCAGGTCCTCGAGGTG
CCTGATCACCCGTACTTCGTCGGGTTCCAAGCACACCCCGAGTTTTGCACGAGACCTTTGAACCCGTCGCCTCCG
TTCCTCGGTTTTGTAGCGGCTTCTTCAGGCCAGACTGTCTTGAACGAGCAGCTTGAGCACCAACTCACGCACTTC
CACCCACCGCACCCGGAAGGCTCGATGGTAAGCGAGGCGGAGCTCAGACGGACGGAGACACCACCTCCTGGCGTG
GAGAAGGTCTTGCGCTCCGAGTAA
Transcript >RhoplFPRL280|19_7
ATGACCAAGTACATTCTCGTCTCCGGCGGTGTCGTCAGTGGCATTGGGAAGGGGGTAATTGCCTCTTCGACAGGC
TTGCTCCTGAAGACGGCTGGTCTGAAGGTGACCGCCATCAAGATTGATCCGTACATGAATATAGATGCAGGAACC
ATGCGCCCGCAAGAGCATGGTGAGGTCTATGTCCTGAACGACGGCGGAGAAGTCGATCTCGACCTCGGAAATTAT
GAACGCTATCTGGACGTTACTCTGTCCCGAGACAACAACATCACGACAGGAAAAATCTATCGCGAGGTTATTGAG
AAAGAGCGGAGAGGAGATTATCTAGGGAAAACGGTCCAGATTGTGCCTCATGTCACTAATGCTATTCAAGATTGG
ATTGAGCGAGTGTCAAAAGTTCCTGTTGACGAGACAGGAGAAGAGCCTGATGTTTGCATTGTCGAGCTAGGAGGC
ACAGTAGGTGACATCGAGTCGGCACCGTTCGTCGAGGCGATGCGACAGTTCCAATTCCGCGTGGGATATGAGAAC
TTCGCGCTTATCCATGTATCACTCGTCCCGGATATGCACGGCGAGCAAAAAACAAAACCAACGCAGACTACAGTC
CATGCTCTGCGAGGACTTGGTCTCCTCCCCGACCTGATCGCTTGCCGACTGGTCGTCCAAAAGCCCCTTGAGCCG
GCAACGAAGTCAAAAATCTCCATGTTTTGTCATGTTGCGCCTGAGCAAGTCATCGGCGTGCATGACGTCTCGTCC
GTCTATCACGTTCCCCTCCTATTGCAGTCGCAGGGCATTGTAGAATACCTCCACAAGCGTCTGAATCTCGCGAGC
ATCAAATTGACATCGGAGATGCAGGAGCGCGGCTCTTGTCTTGGGGTGAGATGGAAAGAGCTGACCAAACGACAA
GAGCGGGTGTTTGATGACGTGACAATTGCGCTGGTTGGGAAGTACACTGACCTCCAGGACTCTTATATGTCTGTC
ACTAAGTCACTGGAGCATTCTGCATTCCGCTGCAACCGGCGACTGATCCTGAAGTGGGTCGACTCGTCACATTTG
GAGCCTGAAACACAGACCTCAGATCCGGCCAAGTATCACGACGCGTGGAGAGCTGTCGTTGCTGCGGGTGGCATC
CTCGTTCCAGGGGGCTTTGGCGAGCGAGGATCAGAGGGCATGATGTTGGCAATCAAGTGGGCTCGCGAGCAGAAA
GTTCCCTTCTTGGGTATATGCTTCGGGTTCCAGCTGGCAGTCGTGGAGTGGGCGCGGAATGTCTGCGGCCTGACA
GGAGCCACCTCCGGCGAGTTCCACCCCGATGCAAAGCATCCGATTATCATTTTCATGCCTGAGATCTCAACAACG
CATATGGGGGGGACGATGCGTCTTGGCCTGCGTCCGACCGTCTTCGAGCCTGAGACAGAGACCCGTTCGAAGGTG
CGGAAACTCTATGGCGGCGCGGGCAAAATTTGGGAGCGGCATAGACACCGCTATGAAGTCAACCCGGCATACATC
GAAAAGCTCACTGCGAGCGGGATGTCCTTCATCGGCAAGGACGAGAGGGGGGAGCGGATGCAGGTCCTCGAGGTG
CCTGATCACCCGTACTTCGTCGGGTTCCAAGCACACCCCGAGTTTTGCACGAGACCTTTGAACCCGTCGCCTCCG
TTCCTCGGTTTTGTAGCGGCTTCTTCAGGCCAGACTGTCTTGAACGAGCAGCTTGAGCACCAACTCACGCACTTC
CACCCACCGCACCCGGAAGGCTCGATGGTAAGCGAGGCGGAGCTCAGACGGACGGAGACACCACCTCCTGGCGTG
GAGAAGGTCTTGCGCTCCGAGTAA
Gene >RhoplFPRL280|19_7
ATGACCAAGTACATTCTCGTCTCCGGCGGTGTCGTCAGTGGCATTGGGAAGGGGGTAATTGGTACGCCTTAGCGT
ATCTTATTTTCTACCGACAAGCTGTGTTCAAGCGCCACCATAGCCTCTTCGACAGGCTTGCTCCTGAAGACGGCT
GGTCTGAAGGTGACCGCCATCAAGATTGATCCGTACATGAATATAGATGCAGGAACCATGCGCCCGCAAGAGCAT
GGTGAGCTATGCGTATCTACAGGTCTGAGCCTATCTAAGAGCGAGAGCATAGGTGAGGTCTATGTCCTGAACGAC
GGCGGAGAAGTCGATCTCGACCTCGGAAATTATGAACGCTATCTGGACGTTACTCTGTCCCGAGACAACAACATC
ACGACAGGAAAAATCTATCGCGAGGTTATTGAGAAAGAGGTTTGTCTCAACATGTCTTTTCTCTTAAATAAGGCA
CCGACCACGATTCAACACTAGCGGAGAGGAGATTATCTAGGGAAAACGGTCCAGGTGCGTTATAATCTTGCACCA
GATGAAACACGTCTGGTGCCCCATCATGACGAACTGAATTTTATCCGACTAGATTGTGCCTCATGTCACTAATGC
TATTCAAGATTGGATTGAGCGAGTGTCAAAAGTTCCTGTTGACGAGACAGGAGAAGAGCCTGATGTTTGCATTGT
CGAGGTGTGTCGTATTGACTGAGTGTACGTCTTCTAGCGTGCTAAAGAGCACCGGCGTGCCACAGCTAGGAGGCA
CAGTAGGTGACATCGAGTCGGCACCGTTCGTCGAGGCGATGCGACAGTTCCAATTCCGCGTGGGATATGAGAACT
TCGCGCTTATCCATGTATCACTCGTCCCGGATATGCACGGCGAGCAAAAAACAAAACCAACGCAGACTACAGTCC
ATGCTCTGCGAGGACTTGGTCTCCTCCCCGACCTGGTTTGTCTCATGTCACCTTTCTCGTGCTCCAGTAGGGCAA
AGCTTGACTCGACGTATCGCAGATCGCTTGCCGACTGGTCGTCCAAAAGCCCCTTGAGCCGGCAACGAAGTCAAA
AATCTCCATGTTTTGTCATGTTGCGCCTGAGCAAGTCATCGGCGTGCATGACGTCTCGTCCGTCTATCACGTTCC
CCTCCTATTGCAGTCGCAGGGCATTGTAGAATACCTCCACAAGCGTCTGAATCTCGCGAGCATCAAATTGACATC
GGAGATGCAGGAGCGCGGCTCTTGTCTTGGGGTGAGATGGAAAGAGCTGACCAAACGGTAGGGTGATTCAATTAA
CAAACCTATTAGGCGGAATGACTAATTCTCTGATATGTGTCTCTGTCCATAGACAAGAGCGGGTGTTTGATGACG
TGACAATTGCGCTGGTTGGGAAGTACACTGACCTCCAGGACTCTTATATGTCTGTCACTAAGTCACTGGAGCATT
CTGCATTCCGCTGCAACCGGCGACTGATCCTGAAGGTGCGTTGCTACTCGACACAAGTCGCTAGAATTTTTCCTG
ACCACGCTTCTATCCTTAGTGGGTCGACTCGTCACATTTGGAGCCTGAAACACAGACCTCAGATCCGGCCAAGTA
TCACGACGCGTGGAGAGCTGTCGTTGCTGCGGGGTACGAGTATCCCTCTCTTTTGATACAATTATTCCCTCCTAG
TTCTTCGTGACCGGGCGTACGCTGATATTTCGTCTAAAGTGGCATCCTCGTTCCAGGGGGCTTTGGCGAGCGAGG
ATCAGAGGGCATGATGTTGGCAATCAAGTGGGCTCGCGAGCAGAAAGTTCCCTTCTTGGGTATATGCTTCGGGTT
CCAGCTGGCAGTCGTGGAGTGGGCGCGGAATGTCTGCGGCCTGACAGGTATTCAATCATGAGTCATACTCCAGAC
AAGGACACTGACCATGAATTCGACCCTACAGGAGCCACCTCCGGCGAGTTCCACCCCGATGCAAAGCATCCGATT
ATCATTTTCATGCCTGAGATCTCAACAACGCATATGGGGGGGACGATGCGTCTTGGCCTGCGTCCGACCGTCTTC
GAGCCTGAGACAGAGACCCGTTCGAAGGTGCGGAAACTCTATGGCGGCGCGGGCAAAATTTGGGAGCGGCATAGA
CACCGCTATGAAGTCAACCCGGCATACATCGAAAAGCTCACTGCGAGCGGGATGTCCTTCATCGGCAAGGACGAG
AGGGGGGAGCGGATGCAGGTCCTCGAGGTGCCTGGTATGTCGCGTTGCCCCCGAACAGAGCGTCTGCGCCGTGAT
TGACTTCTGCCCTAGATCACCCGTACTTCGTCGGGTTCCAAGCACACCCCGAGTTTTGCACGAGACCTTTGAACC
CGTCGCCTCCGTTCCTCGGTTTTGTAGCGGCTTCTTCAGGCCAGACTGTCTTGAACGAGCAGCTTGAGCACCAAC
TCACGCACTTCCACCCACCGCACCCGGAAGGCTCGATGGTAAGCGAGGCGGAGCTCAGACGGACGGAGACACCAC
CTCCTGGCGTGGAGAAGGTCTTGCGCTCCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail