Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|19_17
Gene name
LocationNODE_19:32158..33280
Strand-
Gene length (bp)1122
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 3.3E-06 183 244

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|19_17
MSSKRKWDQAAPEEGETPTKAMKGEDGKTASEAAAAAAAIAAKIAAQFANAGAGGGTPLGKDPHDGDFTQDIDIN
DVRNRYLLTKGSTQTQIHEETGASVSTKGVWYPDRSKATEKDPPLYLHISATTQEIMQKAVDKVNELISMDMGSL
VEDKKDRLRERRKWPEEKIPVGIDTIRNFNVRAKVVGPSGMFVKYIQQETGTRVQIKGIGSGFVDQETGHEHDEP
MFIHVTGPDEGQVQRAKVLTEDLLEVVRQEHAKVKTVVQQQQMELHQAQIQYAAYSAYAVCMLHSFSRPSYTTVA
AA*
Coding >RhoplFPRL280|19_17
ATGTCTTCCAAACGCAAATGGGACCAGGCTGCTCCAGAAGAGGGTGAAACACCCACAAAAGCAATGAAGGGCGAA
GATGGAAAGACGGCGTCCGAGGCTGCTGCAGCCGCAGCCGCCATCGCTGCAAAAATTGCGGCCCAATTCGCGAAT
GCCGGAGCCGGAGGAGGGACACCATTGGGAAAGGATCCACATGATGGAGATTTTACGCAGGACATTGACATTAAC
GATGTACGCAATCGGTATCTGTTGACGAAAGGCTCGACACAGACACAGATCCATGAGGAGACCGGAGCGTCCGTC
AGCACTAAAGGTGTATGGTATCCTGACCGTTCGAAAGCTACAGAAAAGGACCCTCCTCTTTATCTCCACATTTCT
GCCACGACGCAAGAGATCATGCAGAAAGCCGTCGATAAAGTGAATGAACTTATTTCGATGGACATGGGGTCACTG
GTGGAGGACAAGAAGGACCGGTTGCGAGAACGGCGCAAGTGGCCAGAGGAAAAGATTCCTGTAGGTATCGATACG
ATCCGCAACTTCAACGTGCGCGCAAAGGTTGTAGGACCCTCGGGCATGTTCGTCAAATATATCCAGCAAGAGACG
GGAACTCGGGTGCAGATCAAAGGTATCGGTTCTGGTTTCGTTGACCAAGAGACAGGCCACGAACACGATGAGCCC
ATGTTTATTCATGTGACCGGGCCTGATGAGGGTCAGGTTCAACGCGCGAAAGTCCTCACTGAGGACCTGCTCGAG
GTCGTCCGCCAGGAGCATGCGAAAGTGAAGACCGTTGTGCAGCAGCAACAGATGGAGCTGCATCAAGCCCAGATC
CAGTACGCCGCCTACAGTGCTTACGCCGTATGTATGCTCCACTCATTCTCTCGTCCTTCCTATACGACAGTCGCC
GCCGCTTGA
Transcript >RhoplFPRL280|19_17
ATGTCTTCCAAACGCAAATGGGACCAGGCTGCTCCAGAAGAGGGTGAAACACCCACAAAAGCAATGAAGGGCGAA
GATGGAAAGACGGCGTCCGAGGCTGCTGCAGCCGCAGCCGCCATCGCTGCAAAAATTGCGGCCCAATTCGCGAAT
GCCGGAGCCGGAGGAGGGACACCATTGGGAAAGGATCCACATGATGGAGATTTTACGCAGGACATTGACATTAAC
GATGTACGCAATCGGTATCTGTTGACGAAAGGCTCGACACAGACACAGATCCATGAGGAGACCGGAGCGTCCGTC
AGCACTAAAGGTGTATGGTATCCTGACCGTTCGAAAGCTACAGAAAAGGACCCTCCTCTTTATCTCCACATTTCT
GCCACGACGCAAGAGATCATGCAGAAAGCCGTCGATAAAGTGAATGAACTTATTTCGATGGACATGGGGTCACTG
GTGGAGGACAAGAAGGACCGGTTGCGAGAACGGCGCAAGTGGCCAGAGGAAAAGATTCCTGTAGGTATCGATACG
ATCCGCAACTTCAACGTGCGCGCAAAGGTTGTAGGACCCTCGGGCATGTTCGTCAAATATATCCAGCAAGAGACG
GGAACTCGGGTGCAGATCAAAGGTATCGGTTCTGGTTTCGTTGACCAAGAGACAGGCCACGAACACGATGAGCCC
ATGTTTATTCATGTGACCGGGCCTGATGAGGGTCAGGTTCAACGCGCGAAAGTCCTCACTGAGGACCTGCTCGAG
GTCGTCCGCCAGGAGCATGCGAAAGTGAAGACCGTTGTGCAGCAGCAACAGATGGAGCTGCATCAAGCCCAGATC
CAGTACGCCGCCTACAGTGCTTACGCCGTATGTATGCTCCACTCATTCTCTCGTCCTTCCTATACGACAGTCGCC
GCCGCTTGA
Gene >RhoplFPRL280|19_17
ATGTCTTCCAAACGCAAATGGGACCAGGCTGCTCCAGAAGAGGGTGAAACACCCACAAAAGCAATGAAGGGCGAA
GATGGAAAGACGGCGTCCGAGGCTGCTGCAGCCGCAGCCGCCATCGCTGCAAAAATTGCGGCCCAATTCGCGAAT
GCCGGAGCCGGAGGAGGGACACCATTGGGAAAGGATCCACATGATGGAGATTTTACGCAGGACATTGACATTAAC
GATGTACGCAATCGGTATCTGTTGACGAAAGGCTCGACACAGACACAGGTGAGTCCTCAATCTCAATGAGCTCGC
TGGAGTTACAATGAATAACATCTACTTCTCGCTAGATCCATGAGGAGACCGGAGCGTCCGTCAGCACTAAAGGTG
TATGGTATCCTGACCGTTCGAAAGCTACAGAAAAGGACCCTCCTCTTTATCTCCACATTTCTGCCACGACGCAAG
AGATCATGCAGAAAGCCGTCGATAAAGTGAATGAACTTATTTCGATGGACATGGGGTCACTGGTGGAGGACAAGA
AGGACCGGTTGCGAGAACGGGTATGTCTTGAAGTCGATGGAACCAGGTCTACTTCTTGAACGGTTGTTTGCAGCG
CAAGTGGCCAGAGGAAAAGATTCCTGTAGGTATCGATACGATCCGCAACTTCAACGTGCGCGCAAAGGTTGTAGG
ACCCTCGGTATGTTCCTTCTGCTTGCGCATGATGCACGAGTCTTACTGGCATGTAGGGCATGTTCGTCAAATATA
TCCAGCAAGAGACGGGAACTCGGGTGCAGATCAAAGGTATCGGTTCTGGTTTCGTTGACCAAGAGACAGGCCACG
AACACGATGAGCCCATGTTTATTCATGTGACGTACGTGCAGTCTATCCGGCACGTATATGTATATACTCATACTT
TCCAGCGGGCCTGATGAGGGTCAGGTTCAACGCGCGAAAGTCCTCACTGAGGACCTGCTCGAGGTCGTCCGCCAG
GAGCATGCGAAAGTGAAGACCGTTGTGCAGCAGCAACAGATGGAGCTGCATCAAGCCCAGATCCAGTACGCCGCC
TACAGTGCTTACGCCGTATGTATGCTCCACTCATTCTCTCGTCCTTCCTATACGACAGTCGCCGCCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail