Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|19_13
Gene name
LocationNODE_19:24568..26097
Strand-
Gene length (bp)1529
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 2.4E-29 29 136
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.8E-16 175 304
PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus 7.4E-14 167 334
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.2E-06 225 337
PF01494 FAD_binding_3 FAD binding domain 8.5E-05 167 195

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|19_13
MATTMKAVYYHAPRNFEIREVPVPQVGDDDVLFKVRCCGICGTDGHVHAGEFISSFPLIPGHEVVGEVAAFGKNV
TGLAKGDRVVADPGVTCGACFFCRRGQSLLCENFQGKGVSASEPGGFSEYITFAAKKVYKIQNLSDEEATLIEPA
ACAIHGMDKLGTAVGIEALVIGAGPTGLILAQLLKLNGAQRVVIAANKGIKTDIAKQLDAGHEYVELDRVNPGEQ
WEKLKQENPYGFDVVVEATGSEKVANDSINYVRRGGTLMVYGVYDNSALVHWPPSKIFVDEIKIIGSFAQTHCFP
RAVAYLDSGKIRVKGMVTDVYSISDYQKALDKMNSRGALKIAVRA*
Coding >RhoplFPRL280|19_13
ATGGCGACCACAATGAAGGCTGTCTACTACCATGCTCCTCGAAACTTTGAAATCCGGGAGGTGCCTGTACCTCAA
GTAGGGGACGACGATGTACTGTTCAAGGTCCGATGTTGTGGTATCTGCGGTACCGATGGCCATGTCCACGCAGGG
GAATTCATCTCATCATTCCCGTTAATCCCTGGACATGAGGTTGTGGGTGAAGTAGCTGCTTTCGGGAAGAACGTG
ACTGGCCTCGCCAAAGGTGACCGTGTCGTCGCCGATCCTGGCGTAACGTGTGGAGCGTGTTTCTTCTGTCGCCGT
GGCCAGTCCTTGCTATGCGAGAATTTCCAGGGCAAGGGCGTCAGCGCAAGCGAACCCGGCGGGTTCAGTGAATAC
ATCACATTCGCAGCAAAGAAAGTATACAAGATCCAGAACCTCAGCGACGAAGAGGCTACTCTCATCGAGCCTGCT
GCATGCGCCATTCACGGCATGGACAAGCTCGGCACAGCCGTTGGCATAGAAGCACTCGTCATCGGCGCGGGGCCA
ACTGGCCTGATCCTTGCACAACTCCTCAAACTGAACGGCGCGCAGAGGGTAGTCATCGCTGCGAATAAAGGTATC
AAGACAGACATCGCCAAGCAACTGGATGCGGGCCACGAGTATGTCGAGCTCGACAGAGTGAACCCCGGGGAACAG
TGGGAGAAGCTCAAACAGGAGAATCCGTACGGATTTGACGTCGTCGTCGAGGCCACAGGCTCGGAAAAAGTAGCA
AACGACTCCATCAATTATGTCCGCCGAGGGGGGACACTCATGGTCTACGGCGTCTACGACAACTCTGCGCTTGTC
CACTGGCCACCCTCCAAGATTTTTGTAGACGAGATAAAGATCATCGGCTCGTTCGCGCAAACACATTGCTTCCCT
CGCGCTGTTGCGTATCTTGATAGCGGCAAGATTCGTGTGAAGGGCATGGTGACAGACGTCTACTCAATATCAGAC
TACCAGAAGGCGTTGGACAAGATGAACAGCCGTGGAGCTTTGAAGATAGCTGTCAGGGCTTGA
Transcript >RhoplFPRL280|19_13
ATGGCGACCACAATGAAGGCTGTCTACTACCATGCTCCTCGAAACTTTGAAATCCGGGAGGTGCCTGTACCTCAA
GTAGGGGACGACGATGTACTGTTCAAGGTCCGATGTTGTGGTATCTGCGGTACCGATGGCCATGTCCACGCAGGG
GAATTCATCTCATCATTCCCGTTAATCCCTGGACATGAGGTTGTGGGTGAAGTAGCTGCTTTCGGGAAGAACGTG
ACTGGCCTCGCCAAAGGTGACCGTGTCGTCGCCGATCCTGGCGTAACGTGTGGAGCGTGTTTCTTCTGTCGCCGT
GGCCAGTCCTTGCTATGCGAGAATTTCCAGGGCAAGGGCGTCAGCGCAAGCGAACCCGGCGGGTTCAGTGAATAC
ATCACATTCGCAGCAAAGAAAGTATACAAGATCCAGAACCTCAGCGACGAAGAGGCTACTCTCATCGAGCCTGCT
GCATGCGCCATTCACGGCATGGACAAGCTCGGCACAGCCGTTGGCATAGAAGCACTCGTCATCGGCGCGGGGCCA
ACTGGCCTGATCCTTGCACAACTCCTCAAACTGAACGGCGCGCAGAGGGTAGTCATCGCTGCGAATAAAGGTATC
AAGACAGACATCGCCAAGCAACTGGATGCGGGCCACGAGTATGTCGAGCTCGACAGAGTGAACCCCGGGGAACAG
TGGGAGAAGCTCAAACAGGAGAATCCGTACGGATTTGACGTCGTCGTCGAGGCCACAGGCTCGGAAAAAGTAGCA
AACGACTCCATCAATTATGTCCGCCGAGGGGGGACACTCATGGTCTACGGCGTCTACGACAACTCTGCGCTTGTC
CACTGGCCACCCTCCAAGATTTTTGTAGACGAGATAAAGATCATCGGCTCGTTCGCGCAAACACATTGCTTCCCT
CGCGCTGTTGCGTATCTTGATAGCGGCAAGATTCGTGTGAAGGGCATGGTGACAGACGTCTACTCAATATCAGAC
TACCAGAAGGCGTTGGACAAGATGAACAGCCGTGGAGCTTTGAAGATAGCTGTCAGGGCTTGA
Gene >RhoplFPRL280|19_13
ATGGCGACCACAATGAAGGCTGTCTACTACCATGCTGTACGATTCAAAATCGAAGGTGTCACTGATGCGCTCCTG
AAATAAACGTGTGTCAATAGCCTCGAAACTTTGAAATCCGGGAGGTGCCTGTACCTCAAGTAGGGGACGACGATG
TACTGTTCAAGGGTAAAACGCTCGCACACGACTGTTATCATGCGATGGCTGACGATGTTCCTCATCCGGTATGGG
ATCAGTCCGATGTTGTGGTATCTGCGGTACCGATGGCCATGTCCACGCAGGGGAATTCATCTCATCATTCCCGGT
GAATAGCGTCAGTCTCGCTTCGGCAGTCTCACCGGCTAATCAGTGCTTTAGTTAATCCCTGGACATGAGGTTGTG
GGTGAAGTAGCTGCTTTCGGGAAGAACGTGACTGGCCTCGCCAAAGGTGACCGTGTCGTCGCCGATCCTGGCGTA
ACGGTGAGCAGTCCTCGAGAGATCGATGGCGTGCTCAACGAAACTCGACTTTGACTTGCAGTGTGGAGCGTGTTT
CTTCTGTCGCCGTGGCCAGTCCTTGCTATGCGAGAATTTCCAGGGCAAGGGCGTCAGCGCAAGCGAACCCGGCGG
GTTCAGTGAATACATCACATTGTTTGAACTCTCGCCTGTTCGGCCGTGCTATTTTCTCATGACCTAATTAGCGCA
GCAAAGAAAGTATACAAGATCCAGAACCTCAGCGACGAAGAGGCTACTCTCATCGAGCCTGCTGCATGCGCCATT
CACGGCATGGACAAGCTCGGCACAGCCGTTGGCATAGAAGCACTCGTCATCGGCGCGGGGCCAACTGGCCTGATC
CTTGCACAACTCCTCAAACTGAACGGCGCGCAGAGGGTAGTCATCGCTGCGAATAAAGGTATCAAGACAGACATC
GCCAAGCAACTGGATGCGGGCCACGAGTATGTCGAGCTCGACAGAGTGAACCCCGGGGAACAGTGGGAGAAGCTC
AAACAGGAGAATCCGTACGGATTTGACGTCGTCGTAAGTTGTGCACCCTGCAATCAGTCGATCTCGTGCGGCGAC
CTTCAAGTGAAGGATATCCAAGGACTGACATAAAATGGATCGCAGGTCGAGGCCACAGGCTCGGAAAAAGTAGCA
AACGACTCCATCAATTATGTCCGCCGAGGGGGGACACTCATGGTCTACGGCGTCTACGACAACTCTGCGCTTGTC
CACTGGCCACCCTCCAAGATTTTTGTAGACGAGATAAAGGTTCGCTGATCCTCATAAGCAAACAGCTACAACTTT
CTGATGCATTTTGTGTAGATCATCGGCTCGTTCGCGCAAACACATTGCTTCCCTCGCGCTGTTGCGTATCTTGAT
AGCGGCAAGATTCGTGTGAAGGGCATGGTCAGTGCTCACCTTAGATCTAGGGCGTACTGTGCTTCTAACATCAAA
TCACGGCGCTGCAGGTGACAGACGTCTACTCAATATCAGACTACCAGAAGGCGTTGGACAAGATGAACAGCCGTG
GAGCTTTGAAGATAGCTGTCAGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail