Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|19_10
Gene name
LocationNODE_19:29595..31224
Strand-
Gene length (bp)1629
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 4.2E-32 74 363
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.6E-13 74 291
PF07993 NAD_binding_4 Male sterility protein 8.2E-10 158 267
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 9.4E-08 74 206
PF08659 KR KR domain 1.4E-05 73 209

GO

GO Term Description Terminal node
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0003674 molecular_function No
GO:0008610 lipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016229 steroid dehydrogenase activity No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 4 19 15
2 73 92 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|19_10
MPSLIWVALGSLLVVVLYIRHNDSKLSRLPPEATTFSPNRWKSDAVDQTAKELANSHASLLAGNSPPKTGRRYIV
TGGAGFLGGWIVLHLLARGEDPRRIRVVDIRLPIRNDLTQGAAKDVDFIQVDVTDAQAVDAAFRKPWPVPSDVSG
EPEPEVTVFHTAATIRFFERHQALLQYSEQVNVKGTQNILDAARRIGVTTFIYTSSGSISVRRTRFWLWPWEKEP
VHFVQPINDDDTLVPKRHDDYFSNYAVSKRTAELVVRAADKTPSGKGFIRTGCIRPGNGIYGPGGDLLVGQYLAK
KTNPTWIPNILQSFIYVENCSLAHLCYEQRLLEVQAGGHNPDVGGQAFCVADAGPAPTYGEVYDALTQLTSGTTV
FPRLSCTAMLGLAHLIEAYYLLRHFLLQSPLALLGRLLPALNGDIVFLQPSMFALTVVHLIFDDSRARAPPEKGG
LGYNGSVTTLEGVCKVFVEHQKGDGKGWQRVIAGHKEIGHGFGLAKAEAAVEDIIEKVGNGIGVPAEKILSAASK
*
Coding >RhoplFPRL280|19_10
ATGCCTTCTTTGATATGGGTAGCACTCGGTTCACTACTGGTAGTCGTTCTCTACATTCGACACAATGATTCCAAG
CTGTCGCGTCTGCCGCCAGAGGCAACCACGTTCTCTCCAAACCGATGGAAATCCGACGCAGTAGATCAGACGGCA
AAGGAATTGGCGAATTCGCACGCGTCTCTGCTTGCCGGAAATTCACCCCCCAAAACTGGCCGCAGGTACATAGTG
ACAGGCGGGGCTGGTTTCCTGGGCGGATGGATTGTGTTGCACCTTCTCGCCCGCGGCGAGGACCCGCGGCGCATC
AGGGTGGTCGACATCCGCTTACCCATCCGCAACGATCTCACTCAAGGTGCTGCCAAGGATGTGGACTTCATCCAG
GTCGATGTGACCGACGCGCAGGCGGTAGATGCTGCCTTCCGCAAGCCATGGCCTGTGCCCTCCGATGTGTCAGGC
GAGCCTGAGCCCGAAGTCACCGTGTTTCACACTGCAGCAACGATACGTTTCTTCGAGCGCCATCAGGCTTTATTG
CAATACTCAGAGCAGGTCAACGTAAAAGGTACACAGAACATCCTGGACGCGGCACGTCGCATCGGCGTGACCACC
TTCATATACACATCCTCTGGCTCTATCTCTGTGAGGAGGACCCGATTCTGGTTGTGGCCCTGGGAGAAGGAGCCG
GTGCACTTCGTGCAGCCCATCAACGACGACGACACCCTGGTACCCAAACGGCATGACGACTATTTCTCCAATTAC
GCCGTTTCGAAGCGTACCGCCGAGCTGGTCGTGCGCGCAGCGGACAAGACGCCCTCCGGCAAGGGGTTCATCCGC
ACAGGATGCATACGCCCCGGTAACGGCATCTATGGTCCCGGCGGCGACCTGCTAGTCGGGCAGTATCTTGCCAAG
AAGACGAACCCGACGTGGATCCCGAACATCCTTCAGTCGTTCATCTACGTCGAGAACTGCTCGCTTGCGCATCTC
TGCTACGAACAGCGGCTTCTCGAAGTGCAGGCCGGTGGGCACAACCCAGATGTCGGTGGGCAGGCGTTTTGCGTC
GCGGACGCGGGCCCCGCGCCCACCTACGGCGAGGTGTACGACGCGCTCACGCAACTGACCAGTGGCACCACCGTC
TTTCCGCGCCTCTCGTGCACGGCGATGCTCGGACTCGCACACCTCATCGAAGCGTACTACCTCTTGCGGCACTTC
CTCTTGCAGTCGCCTCTCGCCCTGCTCGGACGACTCCTGCCTGCGCTGAACGGCGACATCGTGTTCCTGCAGCCG
TCCATGTTCGCGCTGACAGTCGTGCACCTGATCTTTGACGACTCTCGGGCGCGCGCACCGCCCGAGAAGGGCGGG
CTCGGATACAACGGCAGTGTCACAACGCTCGAGGGCGTGTGCAAAGTCTTTGTGGAGCACCAGAAAGGTGACGGA
AAGGGCTGGCAGCGGGTCATTGCAGGGCACAAAGAAATCGGGCACGGCTTTGGGCTCGCAAAGGCCGAGGCCGCC
GTCGAAGACATTATCGAGAAGGTGGGCAACGGCATCGGCGTCCCTGCGGAGAAGATCCTCAGCGCGGCATCCAAG
TGA
Transcript >RhoplFPRL280|19_10
ATGCCTTCTTTGATATGGGTAGCACTCGGTTCACTACTGGTAGTCGTTCTCTACATTCGACACAATGATTCCAAG
CTGTCGCGTCTGCCGCCAGAGGCAACCACGTTCTCTCCAAACCGATGGAAATCCGACGCAGTAGATCAGACGGCA
AAGGAATTGGCGAATTCGCACGCGTCTCTGCTTGCCGGAAATTCACCCCCCAAAACTGGCCGCAGGTACATAGTG
ACAGGCGGGGCTGGTTTCCTGGGCGGATGGATTGTGTTGCACCTTCTCGCCCGCGGCGAGGACCCGCGGCGCATC
AGGGTGGTCGACATCCGCTTACCCATCCGCAACGATCTCACTCAAGGTGCTGCCAAGGATGTGGACTTCATCCAG
GTCGATGTGACCGACGCGCAGGCGGTAGATGCTGCCTTCCGCAAGCCATGGCCTGTGCCCTCCGATGTGTCAGGC
GAGCCTGAGCCCGAAGTCACCGTGTTTCACACTGCAGCAACGATACGTTTCTTCGAGCGCCATCAGGCTTTATTG
CAATACTCAGAGCAGGTCAACGTAAAAGGTACACAGAACATCCTGGACGCGGCACGTCGCATCGGCGTGACCACC
TTCATATACACATCCTCTGGCTCTATCTCTGTGAGGAGGACCCGATTCTGGTTGTGGCCCTGGGAGAAGGAGCCG
GTGCACTTCGTGCAGCCCATCAACGACGACGACACCCTGGTACCCAAACGGCATGACGACTATTTCTCCAATTAC
GCCGTTTCGAAGCGTACCGCCGAGCTGGTCGTGCGCGCAGCGGACAAGACGCCCTCCGGCAAGGGGTTCATCCGC
ACAGGATGCATACGCCCCGGTAACGGCATCTATGGTCCCGGCGGCGACCTGCTAGTCGGGCAGTATCTTGCCAAG
AAGACGAACCCGACGTGGATCCCGAACATCCTTCAGTCGTTCATCTACGTCGAGAACTGCTCGCTTGCGCATCTC
TGCTACGAACAGCGGCTTCTCGAAGTGCAGGCCGGTGGGCACAACCCAGATGTCGGTGGGCAGGCGTTTTGCGTC
GCGGACGCGGGCCCCGCGCCCACCTACGGCGAGGTGTACGACGCGCTCACGCAACTGACCAGTGGCACCACCGTC
TTTCCGCGCCTCTCGTGCACGGCGATGCTCGGACTCGCACACCTCATCGAAGCGTACTACCTCTTGCGGCACTTC
CTCTTGCAGTCGCCTCTCGCCCTGCTCGGACGACTCCTGCCTGCGCTGAACGGCGACATCGTGTTCCTGCAGCCG
TCCATGTTCGCGCTGACAGTCGTGCACCTGATCTTTGACGACTCTCGGGCGCGCGCACCGCCCGAGAAGGGCGGG
CTCGGATACAACGGCAGTGTCACAACGCTCGAGGGCGTGTGCAAAGTCTTTGTGGAGCACCAGAAAGGTGACGGA
AAGGGCTGGCAGCGGGTCATTGCAGGGCACAAAGAAATCGGGCACGGCTTTGGGCTCGCAAAGGCCGAGGCCGCC
GTCGAAGACATTATCGAGAAGGTGGGCAACGGCATCGGCGTCCCTGCGGAGAAGATCCTCAGCGCGGCATCCAAG
TGA
Gene >RhoplFPRL280|19_10
ATGCCTTCTTTGATATGGGTAGCACTCGGTTCACTACTGGTAGTCGTTCTCTACATTCGACACAATGATTCCAAG
CTGTCGCGTCTGCCGCCAGAGGCAACCACGTTCTCTCCAAACCGATGGAAATCCGACGCAGTAGATCAGACGGCA
AAGGAATTGGCGAATTCGCACGCGTCTCTGCTTGCCGGAAATTCACCCCCCAAAACTGGCCGCAGGTACATAGTG
ACAGGCGGGGTGAGTGGCCATCAAGCGTCTCGAGCTCGGATATGAACGCGTATCTGATAGGCTGGTTTCCTGGGC
GGATGGATTGTGTTGCACCTTCTCGCCCGCGGCGAGGACCCGCGGCGCATCAGGGTGGTCGACATCCGCTTACCC
ATCCGCAACGATCTCACTCAAGGTGCTGCCAAGGATGTGGACTTCATCCAGGTCGATGTGACCGACGCGCAGGCG
GTAGATGCTGCCTTCCGCAAGCCATGGCCTGTGCCCTCCGATGTGTCAGGCGAGCCTGAGCCCGAAGTCACCGTG
TTTCACACTGCAGCAACGATACGTTTCTTCGAGCGCCATCAGGCTTTATTGCAATACTCAGAGCAGGTCAACGTA
AAAGGTACACAGAACATCCTGGACGCGGCACGTCGCATCGGCGTGACCACCTTCATATACACATCCTCTGGCTCT
ATCTCTGTGAGGAGGACCCGATTCTGGTTGTGGCCCTGGGAGAAGGAGCCGGTGCACTTCGTGCAGCCCATCAAC
GACGACGACACCCTGGTACCCAAACGGCATGACGACTATTTCTCCAATTACGCCGTTTCGAAGCGTACCGCCGAG
CTGGTCGTGCGCGCAGCGGACAAGACGCCCTCCGGCAAGGGGTTCATCCGCACAGGATGCATACGCCCCGGTAAC
GGCATCTATGGTCCCGGCGGCGACCTGCTAGTCGGGCAGTATCTTGCCAAGAAGACGAACCCGACGTGGATCCCG
AACATCCTTCAGTCGTTCATCTACGTCGAGAACTGCTCGCTTGCGCATCTCTGCTACGAACAGCGGCTTCTCGAA
GTGCAGGCCGGTGGGCACAACCCAGATGTCGGTGGGCAGGCGTTTTGCGTCGCGGACGCGGGCCCCGCGCCCACC
TACGGCGAGGTGTACGACGCGCTCACGCAACTGACCAGTGGCACCACCGTCTTTCCGCGCCTCTCGTGCACGGCG
ATGCTCGGACTCGCACACCTCATCGAAGCGTACTACCTCTTGCGGCACTTCCTCTTGCAGTCGCCTCTCGCCCTG
CTCGGACGACTCCTGCCTGCGCTGAACGGCGACATCGTGTTCCTGCAGCCGTCCATGTTCGCGCTGACAGTCGTG
CACCTGATCTTTGACGACTCTCGGGCGCGCGCACCGCCCGAGAAGGGCGGGCTCGGATACAACGGCAGTGTCACA
ACGCTCGAGGGCGTGTGCAAAGTCTTTGTGGAGCACCAGAAAGGTGACGGAAAGGGCTGGCAGCGGGTCATTGCA
GGGCACAAAGAAATCGGGCACGGCTTTGGGCTCGCAAAGGCCGAGGCCGCCGTCGAAGACATTATCGAGAAGGTG
GGCAACGGCATCGGCGTCCCTGCGGAGAAGATCCTCAGCGCGGCATCCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail