Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|17_34
Gene name
LocationNODE_17:118638..121348
Strand-
Gene length (bp)2710
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup3822
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|047690
Agaricus bisporus var bisporus H97 AgabiH97|047690
Rhodonia placenta FPRL280 RhoplFPRL280|17_34 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|17_34
MAFGLTIGTERYTTLQNSIQDELVRRGYSPEADPIMAEYITIMIINNKTAAQISSELEDDPNFVDWLFAEAAKGA
PEPSDAPSSSTAAAPAQPSARDSPPHLPTASKDDANRRPPSGPRASAPLYQQALSQALPSTSPTAQKRTASGRSP
SPSGHGHVHKARRIDLPTGPRAMFHGRDVSAGSRSLLERVGPARNGGGGGGLPFGQDDIQARIDTITGAGGSPEM
AMMMAGFPGMNGMGGMGMDMGMASMANPLLLQEMMMNQMALMSQMAGAMGIMPGQLMNGFPMQPGMGGDMFNGGM
QGDGPGRGRGRGRGGPAGRGAGRGRGGHVGANGNAASPVTDAGQASPPPPAAAPAVVAPTPTPVPIVAPVIASTS
SSSSIASQQRTGFVPPHRPQSPTLCKFNLKCTNPLCRYSHPSPVATAESGVVLSNDPCEAGLQCKVSLLDFTGLF
GTSDASVSSSCGALETEHIRSTFHAHYSSTNTVSIWCSLYTPELHIHTPAPRIAWLWGGSDAHPEGRVLPGTFHR
GLSTSAPLVSVKTPEAGSMSGLSHNRSVTFNTSKPNTNAAVLEKKVREVEEKKNEAEKAVAQAEKVAGSKDDASK
PVAISA*
Coding >RhoplFPRL280|17_34
ATGGCTTTTGGACTCACTATTGGGACAGAGCGTTACACTACCCTCCAGAACTCCATCCAAGATGAACTTGTTAGG
CGAGGATATAGTCCCGAAGCGGACCCCATTATGGCGGAGTATATCACCATAATGATCATAAACAACAAGACAGCA
GCTCAAATATCCTCGGAATTGGAAGATGACCCAAATTTCGTCGACTGGTTGTTTGCCGAAGCCGCGAAAGGCGCA
CCTGAACCATCAGACGCGCCGTCATCTTCGACGGCCGCTGCACCCGCCCAGCCTTCTGCGCGTGATTCGCCGCCT
CATCTTCCCACTGCCAGTAAAGACGACGCTAATCGGCGACCTCCAAGCGGACCTCGTGCATCCGCACCTTTGTAT
CAACAAGCCCTATCACAGGCACTCCCTTCTACCTCACCCACCGCACAAAAGCGCACGGCGTCCGGGCGCTCCCCT
TCACCGAGCGGCCATGGTCACGTACACAAGGCGCGACGGATAGACTTACCCACAGGACCGAGGGCGATGTTTCAC
GGGCGCGACGTAAGCGCTGGCTCCCGCAGCCTGCTGGAACGTGTCGGGCCCGCTCGCAATGGCGGCGGCGGTGGC
GGTCTTCCGTTCGGCCAGGACGATATCCAGGCCCGTATTGACACGATCACCGGCGCGGGTGGGTCGCCAGAAATG
GCCATGATGATGGCTGGCTTCCCAGGGATGAACGGAATGGGCGGGATGGGCATGGATATGGGCATGGCGAGCATG
GCGAACCCGCTGCTGTTGCAAGAGATGATGATGAACCAGATGGCCCTCATGTCGCAGATGGCGGGCGCGATGGGT
ATCATGCCGGGGCAGCTGATGAACGGGTTTCCAATGCAGCCCGGCATGGGCGGGGATATGTTCAATGGCGGCATG
CAGGGAGACGGCCCTGGGCGCGGACGCGGGAGAGGGCGCGGCGGCCCTGCTGGTAGGGGGGCTGGCAGAGGAAGA
GGGGGACATGTCGGCGCGAACGGGAACGCTGCAAGTCCTGTGACCGACGCTGGCCAGGCCTCGCCGCCTCCACCT
GCGGCAGCCCCCGCCGTTGTGGCGCCCACACCGACGCCCGTACCGATTGTGGCGCCTGTGATTGCGAGTACATCG
TCGTCGTCGAGCATCGCATCTCAGCAGCGCACGGGCTTCGTCCCGCCCCACAGGCCACAATCGCCTACTCTGTGC
AAGTTCAACCTCAAATGTACGAATCCGCTCTGCCGCTACTCGCACCCATCGCCTGTCGCGACAGCCGAGAGCGGT
GTCGTGCTGAGCAATGACCCGTGTGAGGCGGGATTGCAGTGCAAGGTAAGTTTACTTGATTTTACGGGATTATTC
GGCACGTCTGACGCGAGCGTCTCTTCCAGCTGCGGAGCACTTGAAACCGAGCACATTCGTTCCACCTTCCACGCC
CACTACTCATCTACCAACACCGTGTCGATATGGTGCAGCCTGTACACGCCCGAACTGCACATTCACACACCCGCC
CCGCGCATCGCATGGCTCTGGGGCGGCAGCGACGCCCACCCCGAGGGACGTGTGCTGCCGGGGACGTTCCACCGC
GGGCTGTCCACCAGTGCACCGCTTGTGAGCGTGAAGACGCCGGAGGCGGGCTCGATGAGCGGGCTGAGCCACAAC
CGCAGCGTCACGTTCAACACGAGCAAGCCGAACACGAACGCGGCGGTACTGGAGAAGAAGGTTCGCGAGGTGGAG
GAAAAGAAGAACGAGGCGGAGAAGGCCGTCGCGCAGGCGGAAAAGGTAGCGGGCAGCAAGGACGACGCGTCGAAG
CCCGTCGCGATCAGCGCGTGA
Transcript >RhoplFPRL280|17_34
ATGGCTTTTGGACTCACTATTGGGACAGAGCGTTACACTACCCTCCAGAACTCCATCCAAGATGAACTTGTTAGG
CGAGGATATAGTCCCGAAGCGGACCCCATTATGGCGGAGTATATCACCATAATGATCATAAACAACAAGACAGCA
GCTCAAATATCCTCGGAATTGGAAGATGACCCAAATTTCGTCGACTGGTTGTTTGCCGAAGCCGCGAAAGGCGCA
CCTGAACCATCAGACGCGCCGTCATCTTCGACGGCCGCTGCACCCGCCCAGCCTTCTGCGCGTGATTCGCCGCCT
CATCTTCCCACTGCCAGTAAAGACGACGCTAATCGGCGACCTCCAAGCGGACCTCGTGCATCCGCACCTTTGTAT
CAACAAGCCCTATCACAGGCACTCCCTTCTACCTCACCCACCGCACAAAAGCGCACGGCGTCCGGGCGCTCCCCT
TCACCGAGCGGCCATGGTCACGTACACAAGGCGCGACGGATAGACTTACCCACAGGACCGAGGGCGATGTTTCAC
GGGCGCGACGTAAGCGCTGGCTCCCGCAGCCTGCTGGAACGTGTCGGGCCCGCTCGCAATGGCGGCGGCGGTGGC
GGTCTTCCGTTCGGCCAGGACGATATCCAGGCCCGTATTGACACGATCACCGGCGCGGGTGGGTCGCCAGAAATG
GCCATGATGATGGCTGGCTTCCCAGGGATGAACGGAATGGGCGGGATGGGCATGGATATGGGCATGGCGAGCATG
GCGAACCCGCTGCTGTTGCAAGAGATGATGATGAACCAGATGGCCCTCATGTCGCAGATGGCGGGCGCGATGGGT
ATCATGCCGGGGCAGCTGATGAACGGGTTTCCAATGCAGCCCGGCATGGGCGGGGATATGTTCAATGGCGGCATG
CAGGGAGACGGCCCTGGGCGCGGACGCGGGAGAGGGCGCGGCGGCCCTGCTGGTAGGGGGGCTGGCAGAGGAAGA
GGGGGACATGTCGGCGCGAACGGGAACGCTGCAAGTCCTGTGACCGACGCTGGCCAGGCCTCGCCGCCTCCACCT
GCGGCAGCCCCCGCCGTTGTGGCGCCCACACCGACGCCCGTACCGATTGTGGCGCCTGTGATTGCGAGTACATCG
TCGTCGTCGAGCATCGCATCTCAGCAGCGCACGGGCTTCGTCCCGCCCCACAGGCCACAATCGCCTACTCTGTGC
AAGTTCAACCTCAAATGTACGAATCCGCTCTGCCGCTACTCGCACCCATCGCCTGTCGCGACAGCCGAGAGCGGT
GTCGTGCTGAGCAATGACCCGTGTGAGGCGGGATTGCAGTGCAAGGTAAGTTTACTTGATTTTACGGGATTATTC
GGCACGTCTGACGCGAGCGTCTCTTCCAGCTGCGGAGCACTTGAAACCGAGCACATTCGTTCCACCTTCCACGCC
CACTACTCATCTACCAACACCGTGTCGATATGGTGCAGCCTGTACACGCCCGAACTGCACATTCACACACCCGCC
CCGCGCATCGCATGGCTCTGGGGCGGCAGCGACGCCCACCCCGAGGGACGTGTGCTGCCGGGGACGTTCCACCGC
GGGCTGTCCACCAGTGCACCGCTTGTGAGCGTGAAGACGCCGGAGGCGGGCTCGATGAGCGGGCTGAGCCACAAC
CGCAGCGTCACGTTCAACACGAGCAAGCCGAACACGAACGCGGCGGTACTGGAGAAGAAGGTTCGCGAGGTGGAG
GAAAAGAAGAACGAGGCGGAGAAGGCCGTCGCGCAGGCGGAAAAGGTAGCGGGCAGCAAGGACGACGCGTCGAAG
CCCGTCGCGATCAGCGCGTGA
Gene >RhoplFPRL280|17_34
ATGGCTTTTGGACTCACTATTGGGACAGAGCGTTACACTACCCTCCAGGTTCGTCCTGTCCTTCGTGTGGACCAT
GTTCAAGCTCACCAGACTACCAGAACTCCATCCAAGATGAACTTGTTAGGCGAGGATATAGTCCCGAAGCGGGTA
CGTGCTACTCCTGACCGCTCCATAGTCTTACGCTCAATCCTCTGCAGACCCCATTATGGCGGAGTATATCACCAT
AATGATCATAAACAACAAGACAGCAGGTTCGTCCCCTTTCCACTTGTCGAAACATCTTGCTCACAGCCGTGCAGC
TCAAATATCCTCGGAATTGGAAGATGGTAAGCATACATTGCGCCAAAAGTGTATTTTACTCTTTCTGCGCACTCT
CGAGTCACGGTCCAGGGATGGATTCTGGAGCAAACAGGGACCGTTGAGTCTACCTTCTCGAATTCTCATCCAGTG
GAGCTGGCGTGCGATTCTCAGAGTACTTGGAGAGCCGAACCGTTGTGTTGCCACAACTGTTACGTACCAGGGGAC
TTCGATAACAGGTTGCCAGTTGGCAGAAGCCCAGCGCGTGATTGCTGCGAGCTTGTTCAAGTCCAGGGCTGCATC
CTGTGCTCGGAGCAAACGGGATTGACCTCCATCCGATTCCAGCTTGAGTAAAAATGCCTCCTGGTTGATACACCC
GTTGTGGCACAACCTGGCGTGCAGCTACCTGTACATATCGTTCAGCTACTGCTTTGAAGGGTTTTTTACGTCTGC
GTGAGTGGCGTAACACGTACCGACTGGCCCATGATGAAAGCCTGGCAGTGCGCTAGTCTCGCAGGGTCGTGCAGA
AGAGTTTTGACATCTTTCACTCCATACGCTTCTTGTGAACTTGCGCGCTAACCACGATCTCCTCTACAGTAATAG
GAGCGGATTTCGGTATGTTCTGTCAATCTCATTCGCCGCAACAATTCGCTAATCATCTCCTGCAATCAGACCCAA
ATTTCGTCGACTGGTTGTTTGCCGAAGCCGCGAAAGGCGCACCTGAACCATCAGACGCGCCGTCATCTTCGACGG
CCGCTGCACCCGCCCAGCCTTCTGCGCGTGATTCGCCGCCTCATCTTCCCACTGCCAGTAAAGACGACGCTAATC
GGCGACCTCCAAGCGGACCTCGTGCATCCGCACCTTTGTATCAACAAGCCCTATCACAGGCACTCCCTTCTACCT
CACCCACCGCACAAAAGCGCACGGCGTCCGGGCGCTCCCCTTCACCGAGCGGCCATGGTCACGTACACAAGGCGC
GACGGATAGACTTACCCACAGGACCGAGGGCGATGTTTCACGGGCGCGACGTAAGCGCTGGCTCCCGCAGCCTGC
TGGAACGTGTCGGGCCCGCTCGCAATGGCGGCGGCGGTGGCGGTCTTCCGTTCGGCCAGGACGATATCCAGGCCC
GTATTGACACGATCACCGGCGCGGGTGGGTCGCCAGAAATGGCCATGATGATGGCTGGCTTCCCAGGGATGAACG
GAATGGGCGGGATGGGCATGGATATGGGCATGGCGAGCATGGCGAACCCGCTGCTGTTGCAAGAGATGATGATGA
ACCAGATGGCCCTCATGTCGCAGATGGCGGGCGCGATGGGTATCATGCCGGGGCAGCTGATGAACGGGTTTCCAA
TGCAGCCCGGCATGGGCGGGGATATGTTCAATGGCGGCATGCAGGGAGACGGCCCTGGGCGCGGACGCGGGAGAG
GGCGCGGCGGCCCTGCTGGTAGGGGGGCTGGCAGAGGAAGAGGGGGACATGTCGGCGCGAACGGGAACGCTGCAA
GTCCTGTGACCGACGCTGGCCAGGCCTCGCCGCCTCCACCTGCGGCAGCCCCCGCCGTTGTGGCGCCCACACCGA
CGCCCGTACCGATTGTGGCGCCTGTGATTGCGAGTACATCGTCGTCGTCGAGCATCGCATCTCAGCAGCGCACGG
GCTTCGTCCCGCCCCACAGGCCACAATCGCCTACTCTGTGCAAGTTCAACCTCAAATGTACGAATCCGCTCTGCC
GCTACTCGCACCCATCGCCTGTCGCGACAGCCGAGAGCGGTGTCGTGCTGAGCAATGACCCGTGTGAGGCGGGAT
TGCAGTGCAAGGACAGGGATTGTATCAAGGCGCACGTCAGCCCCGCTGGGCTCCACCCTGGTGGTAAGTTTACTT
GATTTTACGGGATTATTCGGCACGTCTGACGCGAGCGTCTCTTCCAGCTGCGGAGCACTTGAAACCGAGCACATT
CGTTCCACCTTCCACGCCCACTACTCATCTACCAACACCGTGTCGATATGGTGCAGCCTGTACACGCCCGAACTG
CACATTCACACACCCGCCCCGCGCATCGCATGGCTCTGGGGCGGCAGCGACGCCGTGCCGTTTTGGTTCTGCATG
TACGCGCGCGACGTGCCCCTTCCAGCACCCCGAGGGACGTGTGCTGCCGGGGACGTTCCACCGCGGGCTGTCCAC
CAGTGCACCGCTTGTGAGCGTGAAGACGCCGGAGGCGGGCTCGATGAGCGGGCTGAGCCACAACCGCAGCGTCAC
GTTCAACACGAGCAAGCCGAACACGAACGCGGCGGTACTGGAGAAGAAGGTTCGCGAGGTGGAGGAAAAGAAGAA
CGAGGCGGAGAAGGCCGTCGCGCAGGCGGAAAAGGTAGCGGGCAGCAAGGACGACGCGTCGAAGCCCGTCGCGAT
CAGCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail