Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|168_7
Gene name
LocationNODE_168:18689..20995
Strand+
Gene length (bp)2306
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-28 45 407

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 107 125 18
2 131 153 22
3 166 188 22
4 198 220 22
5 269 291 22
6 301 323 22
7 330 352 22
8 357 379 22
9 391 413 22
10 423 445 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|168_7
MSELVQAEKRSLSLTLPFETSPTQSDVDPQKVLRKLDWHLLPFLSLLYLLAYLDRTNVGNAKIAGLTTDIGLTGL
QFNLCSAMFFVTYCAFEVPSNVALKLLRPSRWIPSIMFCWGIIMVSMAFVKDFVGLLIVRLFLGAAESGLLPGLA
FYICLWYPRVAQAQRLAIFVSACTASGAFGGLLAYGIEKMSGTGGLAGWSWIFLLEGLITIVVAVGGWWYMDDYP
ESASFLSVRERDWLVQALKEDTASSSKAIRYEYLMQALKNPYSYLLASIEFFIMIPLFAFALFLPTIIVGLGYSS
LHAQLLTVPPNICGCLATILFGIGSDRLGVRGPFVLAGSLLSLVGYTILLATTTPTIGYIGTIIAACGLVPSSAC
LLAWTGGNAGGDMKRGAMLAMLTGLGDLGAIASSFIYRPQDSPRYRPGHATNIACSSMIAILSIIAMFAFARANK
QKHTRCIQEGLSADNAEDYRELGDNSPLYRCDTVCLKG*
Coding >RhoplFPRL280|168_7
ATGTCTGAGTTAGTTCAGGCTGAAAAGCGCTCCCTCTCCTTGACCTTGCCATTCGAAACGAGTCCGACTCAGTCT
GATGTCGATCCACAAAAGGTGCTACGAAAGTTAGACTGGCACCTCTTACCATTTCTGTCTCTCTTGTATCTCCTT
GCGTATCTTGACAGGACGAATGTCGGAAATGCCAAAATCGCAGGCCTGACTACCGATATAGGACTAACAGGCCTA
CAATTCAACCTGTGCTCAGCCATGTTTTTTGTGACCTACTGTGCATTTGAAGTTCCTTCCAATGTGGCGTTGAAA
TTGCTAAGGCCTTCCCGCTGGATTCCGTCTATTATGTTCTGCTGGGGTATCATCATGGTATCAATGGCTTTTGTC
AAAGACTTTGTAGGACTGTTGATAGTGCGATTATTTCTTGGAGCAGCCGAGTCCGGGCTCCTACCCGGTTTGGCC
TTCTATATATGTCTCTGGTATCCCAGAGTTGCTCAGGCGCAACGACTAGCCATATTCGTATCGGCGTGCACGGCA
TCAGGCGCATTTGGAGGACTTCTGGCATATGGAATAGAAAAAATGTCTGGGACTGGTGGGTTGGCAGGCTGGTCT
TGGATTTTTCTGCTAGAAGGATTGATAACAATTGTGGTCGCAGTTGGCGGATGGTGGTACATGGATGACTATCCG
GAATCAGCATCGTTCCTGAGTGTGCGAGAGAGAGACTGGCTGGTGCAAGCTCTCAAAGAAGATACAGCATCATCG
TCAAAGGCAATCAGATACGAATACCTCATGCAAGCCCTAAAGAATCCCTACTCCTATCTCCTCGCCAGTATAGAA
TTCTTCATTATGATACCCTTATTCGCATTTGCCCTATTTCTGCCCACCATTATTGTTGGCCTAGGCTACTCCTCC
CTTCACGCACAGCTTCTCACTGTACCCCCGAACATCTGTGGTTGCTTGGCCACGATTCTGTTTGGAATAGGGTCT
GACCGGCTTGGTGTCAGAGGGCCATTCGTTCTCGCGGGTTCCCTCTTGTCGCTCGTTGGGTACACCATCCTCTTG
GCGACAACAACTCCCACAATTGGATATATCGGCACAATCATTGCTGCATGCGGCCTTGTCCCGTCTTCTGCCTGC
TTGCTCGCATGGACTGGGGGAAACGCTGGAGGTGATATGAAGCGAGGCGCAATGCTGGCAATGCTGACAGGGCTC
GGCGATCTGGGAGCAATTGCGTCGTCATTCATCTATCGGCCTCAAGATAGTCCGAGATACCGGCCTGGCCATGCA
ACGAATATTGCATGCTCCAGTATGATTGCGATCCTGAGTATTATTGCTATGTTCGCGTTCGCCCGCGCAAACAAA
CAGAAGCATACTCGCTGTATCCAGGAAGGCCTCTCCGCGGACAATGCTGAAGACTACCGTGAACTCGGTGACAAC
TCACCCTTATACAGGTGCGATACAGTATGTCTCAAAGGCTAA
Transcript >RhoplFPRL280|168_7
ATGTCTGAGTTAGTTCAGGCTGAAAAGCGCTCCCTCTCCTTGACCTTGCCATTCGAAACGAGTCCGACTCAGTCT
GATGTCGATCCACAAAAGGTGCTACGAAAGTTAGACTGGCACCTCTTACCATTTCTGTCTCTCTTGTATCTCCTT
GCGTATCTTGACAGGACGAATGTCGGAAATGCCAAAATCGCAGGCCTGACTACCGATATAGGACTAACAGGCCTA
CAATTCAACCTGTGCTCAGCCATGTTTTTTGTGACCTACTGTGCATTTGAAGTTCCTTCCAATGTGGCGTTGAAA
TTGCTAAGGCCTTCCCGCTGGATTCCGTCTATTATGTTCTGCTGGGGTATCATCATGGTATCAATGGCTTTTGTC
AAAGACTTTGTAGGACTGTTGATAGTGCGATTATTTCTTGGAGCAGCCGAGTCCGGGCTCCTACCCGGTTTGGCC
TTCTATATATGTCTCTGGTATCCCAGAGTTGCTCAGGCGCAACGACTAGCCATATTCGTATCGGCGTGCACGGCA
TCAGGCGCATTTGGAGGACTTCTGGCATATGGAATAGAAAAAATGTCTGGGACTGGTGGGTTGGCAGGCTGGTCT
TGGATTTTTCTGCTAGAAGGATTGATAACAATTGTGGTCGCAGTTGGCGGATGGTGGTACATGGATGACTATCCG
GAATCAGCATCGTTCCTGAGTGTGCGAGAGAGAGACTGGCTGGTGCAAGCTCTCAAAGAAGATACAGCATCATCG
TCAAAGGCAATCAGATACGAATACCTCATGCAAGCCCTAAAGAATCCCTACTCCTATCTCCTCGCCAGTATAGAA
TTCTTCATTATGATACCCTTATTCGCATTTGCCCTATTTCTGCCCACCATTATTGTTGGCCTAGGCTACTCCTCC
CTTCACGCACAGCTTCTCACTGTACCCCCGAACATCTGTGGTTGCTTGGCCACGATTCTGTTTGGAATAGGGTCT
GACCGGCTTGGTGTCAGAGGGCCATTCGTTCTCGCGGGTTCCCTCTTGTCGCTCGTTGGGTACACCATCCTCTTG
GCGACAACAACTCCCACAATTGGATATATCGGCACAATCATTGCTGCATGCGGCCTTGTCCCGTCTTCTGCCTGC
TTGCTCGCATGGACTGGGGGAAACGCTGGAGGTGATATGAAGCGAGGCGCAATGCTGGCAATGCTGACAGGGCTC
GGCGATCTGGGAGCAATTGCGTCGTCATTCATCTATCGGCCTCAAGATAGTCCGAGATACCGGCCTGGCCATGCA
ACGAATATTGCATGCTCCAGTATGATTGCGATCCTGAGTATTATTGCTATGTTCGCGTTCGCCCGCGCAAACAAA
CAGAAGCATACTCGCTGTATCCAGGAAGGCCTCTCCGCGGACAATGCTGAAGACTACCGTGAACTCGGTGACAAC
TCACCCTTATACAGGTGCGATACAGTATGTCTCAAAGGCTAA
Gene >RhoplFPRL280|168_7
ATGTCTGAGTTAGTTCAGGCTGAAAAGCGCTCCCTCTCCTTGACCTTGCCATTCGAAACGAGTCCGACTCAGTCT
GATGTCGATCCACAAAAGGTGCTACGAAAGTTAGACTGGCACCTCTTACCATTTCTGTCTCTCTTGTATCTCCTT
GCGTATCTGTAAGCAGATGATATTTAACAGCATGGAGTAGCTGGTGTCAACGCTTATTACGGACACTTCTTCCAG
TGACAGGACGAATGTCGGTAAGCTCCTTTCGGAACCTCTGTCACCTCGTTTTTACGATACTGCCTAGGAAATGCC
AAAATCGCAGGCCTGACTACCGATATAGGACTAACAGGCCTACAATTCAACCTGTGCTCAGCCATGTTTTTTGTA
CGGTCCATGATGCCTTGTGCGCAGCTTACTACTGAATGTACAAATAAAAGGTGACCTACTGTGCATTTGAAGTTC
CTTCGTAAGTGAGGTTGATTATCTCATTTGGAGCTCATTGACAGTCTTTCGGGTACAGCAATGTGGCGTTGAAAT
TGCTAAGGCCTTCCCGCTGGAGTACGCTAATGATTCACCACTTCATGTTTCATATCAAAGCTCACTTTAAAAATG
ACGTGTAGTTCCGTCTATTATGTTCTGCTGGGGTATCATCATGGTATCAATGGCTTTTGTCAAAGACTTTGTAGG
ACTGTTGATGTGCGTTGACCCCTTCCGGCCGAGTTCTGAAGGTGCACTGATGGCGTTGAGCAGAGTGCGATTATT
TCTTGGAGCAGCCGAGGTTCGGCTCGAGTTTGGAATGGATGTCACGGTGATGATGACCTCGTGCTACCGCAGTCC
GGGCTCCTACCCGGTTTGGCCTTCTATATATGTCTCTGGTATCCCAGAGTTGCTCAGGCGCAACGACTAGCCATA
TTCGTATCGGCGTGCACGGCATCAGGTGAGCATCGCTCTGATGTCGCCTTCGCCTTCATTGCAGTACCAATGATA
TAGGCGCATTTGGAGGACTTCTGGCATATGGAATAGAAAAAATGTCTGGGTGCGCAGCTTTCCTAAGCATGGTCG
ACAATACGTGTTGACGGTCCGGTCATAGGACTGGTGGGTTGGCAGGCTGGTCTTGGATTGTGTGTAATTTATGAC
CTTTTCCTAATGCGTGCTAATTGCATTGGGACCCGCAGTTTCTGCTAGAAGGATTGAGTGAGTTGTAATGCTACT
AGTTTGTTCAGTCTTACTCATCATTACACAGTAACAATTGTGGTCGCAGTTGGCGGATGGTGGTACATGGATGAC
GTTCGTATTTAGTGTCACTCTTGCGACATCAAAGCTTACAGGGCCTCCAACAGTATCCGGAATCAGCATCGTTCC
TGAGTGTGCGAGAGAGAGACTGGCTGGTGCAAGCTCTCAAAGAAGATACAGCATCATCGTCAAAGGCAATCAGAT
ACGAATACCTCATGCAAGCCCTAAAGAATCCCTACTCCTATCTCCTCGCCAGTATAGAATTCTTGTGAGATTTCT
GCAATCATGGCTCGGTATCACTCTGATGCTTGATTTCCGTCCAAACCATGGCAGCATTATGATACCCTTATTCGC
ATTTGCCCTATTTCTGCCCACCATTATTGTTGGCCTAGGCTACTCCTCCCTTCACGCACAGCTTCTCACTGTACC
CCCGAACATCTGTGGTTGCTTGGCCACGATTCTGTTTGGAATAGGGTCTGACCGGCTTGGTGTCAGAGGGCCATT
CGTTCTCGCGGGTTCCCTCTTGTCGCTCGTTGGGTACACCATCCTCTTGGCGACAACAACTCCCACAATTGGATA
TATCGGCACAATCATTGCTGCATGCGGCCTTGTCCCGTCTTCTGCCTGCTTGCTCGCATGGACTGGGGGAAACGC
TGGAGGTGATATGAAGCGAGGCGCAATGCTGGCAATGCTGACAGGGCTCGGCGATCTGGGAGCGTAAGTAGTGCC
CCGTCGTGTGGTTTTGTAGGCAACATTTATAAGTTGTGCGCAGAATTGCGTCGTCATTCATCTATCGGCCTCAAG
ATAGTCCGAGATACCGGCCTGGCCATGCAACGAATATTGCATGCTCCAGTATGATGTACGTCATGCTTGGCAGTT
GAGTATCCTGAATCCTCGTATGACATTGCTTGATCAATAGTGCGATCCTGAGTATTATTGCTATGTTCGCGTTCG
CCCGCGCAAACAAACAGAAGCATACTCGCTGTATCCAGGAAGGCCTCTCCGCGGACAATGCTGAAGACTACCGTG
AACTCGGTGACAACTCACCCTTATACAGGTGCGATACAGTATGTCTCAAAGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail