Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|160_2
Gene name
LocationNODE_160:42113..44288
Strand+
Gene length (bp)2175
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15 1.0E-96 32 449
PF00686 CBM_20 Starch binding domain 1.3E-26 476 564

GO

GO Term Description Terminal node
GO:2001070 starch binding Yes
GO:0005488 binding No
GO:0030246 carbohydrate binding No
GO:0003674 molecular_function No
GO:0030247 polysaccharide binding No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.994525

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH15 5.0E-74 47 448
CBM20 3.7E-28 476 561

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup857
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|043320
Agaricus bisporus var bisporus H97 AgabiH97|043320
Rhodonia placenta FPRL280 RhoplFPRL280|160_2 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|160_2
MRLTVVSGLAYACGALAASSSVGSYIASESPVAKAGVLANIGAGGSKSSGAYSGVVIASPSTSNPDYLYTWTRDS
SLTFKALIDQYTSGEDTSLRTLIDEFVSAEATLQQVTNPSGSVSTGGLGEPKFNINETAFTGAWGRPQRDGPALR
ATAVMSYATYLYNSGNTTYVTDTLWPIIELDLNYVAGNWNQSTFDLWEEVDSSSFFTTAVQHRSLRQGIIFANLI
GQTSVVSNYETQAEALLCFLQSYWNPTDNYMTANTGGGRSGKDANTVLASIHTFDLDAGCDATTFQPCSDKALSN
LKVYVDSFRSIYAINDDISSDAAVATGRYPEDTYYNGNPWYLCTLAVAEQLYDALIVWDAQDYLEVTSTSLAFFQ
QFDSSVAAGTYDSSTSTYSTLTSAVKSFADGFTLIVANYTPSDGELSEQYSKSDGSQTSAVDLTWSYASALTAFA
AEAGTSYGSWGAANLSTSSCPSTSGVSVTFEVEYDTEYGENLYITGSVSELEDWSADDALIMSSANYPTWSITVT
LPASTAIQYKYLTKYNGDVTWEDDPNNEITTPASGSVTQSDSWH*
Coding >RhoplFPRL280|160_2
ATGCGTCTCACAGTCGTCTCTGGTCTTGCCTATGCGTGCGGAGCCCTCGCGGCGTCCAGCAGCGTCGGCTCGTAC
ATCGCTTCCGAGTCGCCGGTCGCGAAGGCCGGCGTGCTCGCCAACATCGGTGCGGGCGGCTCAAAGTCGTCTGGT
GCTTATTCCGGCGTTGTGATCGCCAGTCCCAGCACGTCCAACCCGGACTACTTGTACACCTGGACGCGCGACTCG
TCACTGACGTTCAAGGCGCTCATCGACCAGTACACGTCCGGCGAGGACACCTCGCTGCGCACGCTCATCGACGAG
TTCGTCTCCGCCGAGGCGACCCTGCAGCAGGTCACGAACCCCAGCGGCAGCGTGAGCACCGGTGGGCTCGGCGAG
CCGAAGTTCAACATCAATGAGACAGCATTCACTGGAGCCTGGGGCAGGCCGCAGCGCGATGGCCCCGCTCTGCGT
GCGACGGCCGTCATGTCGTACGCGACGTACCTATATAACAGTGGAAACACGACGTATGTCACCGACACGCTCTGG
CCCATCATTGAGCTCGACCTCAACTATGTTGCGGGTAACTGGAACCAGTCAACCTTTGACTTATGGGAGGAAGTG
GATTCGTCCTCGTTCTTCACTACCGCTGTTCAGCACCGTTCCCTTCGGCAAGGAATCATCTTCGCGAACTTGATC
GGCCAAACCTCTGTAGTTTCCAACTACGAGACACAGGCCGAGGCTCTTCTGTGTTTTCTGCAGTCATACTGGAAT
CCTACTGACAATTACATGACCGCGAACACTGGCGGTGGACGCTCCGGTAAGGATGCCAACACCGTCTTGGCTTCG
ATTCACACATTCGACCTGGACGCCGGCTGCGACGCGACGACCTTCCAGCCGTGCTCGGACAAGGCGCTCTCGAAC
CTCAAGGTCTATGTCGACTCGTTCCGGTCGATCTACGCCATCAATGATGACATCTCATCCGACGCAGCTGTCGCG
ACCGGGCGGTACCCCGAGGACACATACTACAATGGAAACCCGTGGTACCTATGCACGCTCGCCGTCGCTGAGCAG
CTGTACGACGCGCTCATTGTGTGGGACGCACAGGACTACCTCGAGGTGACGAGCACGTCGCTCGCGTTCTTCCAG
CAGTTCGACTCGTCTGTCGCCGCGGGGACGTACGACTCAAGCACGAGCACGTACAGCACGCTCACGAGCGCGGTC
AAGAGCTTCGCAGACGGCTTCACGCTCATCGTCGCGAACTATACCCCGTCCGACGGGGAACTGAGCGAGCAGTAC
TCCAAGTCGGACGGGAGCCAGACGAGCGCAGTGGACCTGACGTGGAGCTACGCGTCGGCGCTGACGGCGTTCGCC
GCTGAGGCCGGGACATCGTACGGCAGCTGGGGCGCAGCGAACCTGTCGACATCGTCGTGCCCGAGCACGAGCGGC
GTGTCTGTGACGTTTGAGGTTGAGTACGACACGGAATATGGAGAGAATCTGTACATCACCGGGTCCGTTTCAGAA
TTGGAGGACTGGTCGGCCGACGACGCCCTGATCATGTCCTCCGCGAATTACCCGACATGGAGCATCACAGTGACC
TTGCCTGCGAGCACGGCCATCCAGTACAAGTATCTGACGAAGTACAACGGTGACGTCACCTGGGAGGACGACCCG
AACAACGAGATCACGACACCCGCGAGCGGAAGCGTGACGCAGTCGGATAGCTGGCATTGA
Transcript >RhoplFPRL280|160_2
ATGCGTCTCACAGTCGTCTCTGGTCTTGCCTATGCGTGCGGAGCCCTCGCGGCGTCCAGCAGCGTCGGCTCGTAC
ATCGCTTCCGAGTCGCCGGTCGCGAAGGCCGGCGTGCTCGCCAACATCGGTGCGGGCGGCTCAAAGTCGTCTGGT
GCTTATTCCGGCGTTGTGATCGCCAGTCCCAGCACGTCCAACCCGGACTACTTGTACACCTGGACGCGCGACTCG
TCACTGACGTTCAAGGCGCTCATCGACCAGTACACGTCCGGCGAGGACACCTCGCTGCGCACGCTCATCGACGAG
TTCGTCTCCGCCGAGGCGACCCTGCAGCAGGTCACGAACCCCAGCGGCAGCGTGAGCACCGGTGGGCTCGGCGAG
CCGAAGTTCAACATCAATGAGACAGCATTCACTGGAGCCTGGGGCAGGCCGCAGCGCGATGGCCCCGCTCTGCGT
GCGACGGCCGTCATGTCGTACGCGACGTACCTATATAACAGTGGAAACACGACGTATGTCACCGACACGCTCTGG
CCCATCATTGAGCTCGACCTCAACTATGTTGCGGGTAACTGGAACCAGTCAACCTTTGACTTATGGGAGGAAGTG
GATTCGTCCTCGTTCTTCACTACCGCTGTTCAGCACCGTTCCCTTCGGCAAGGAATCATCTTCGCGAACTTGATC
GGCCAAACCTCTGTAGTTTCCAACTACGAGACACAGGCCGAGGCTCTTCTGTGTTTTCTGCAGTCATACTGGAAT
CCTACTGACAATTACATGACCGCGAACACTGGCGGTGGACGCTCCGGTAAGGATGCCAACACCGTCTTGGCTTCG
ATTCACACATTCGACCTGGACGCCGGCTGCGACGCGACGACCTTCCAGCCGTGCTCGGACAAGGCGCTCTCGAAC
CTCAAGGTCTATGTCGACTCGTTCCGGTCGATCTACGCCATCAATGATGACATCTCATCCGACGCAGCTGTCGCG
ACCGGGCGGTACCCCGAGGACACATACTACAATGGAAACCCGTGGTACCTATGCACGCTCGCCGTCGCTGAGCAG
CTGTACGACGCGCTCATTGTGTGGGACGCACAGGACTACCTCGAGGTGACGAGCACGTCGCTCGCGTTCTTCCAG
CAGTTCGACTCGTCTGTCGCCGCGGGGACGTACGACTCAAGCACGAGCACGTACAGCACGCTCACGAGCGCGGTC
AAGAGCTTCGCAGACGGCTTCACGCTCATCGTCGCGAACTATACCCCGTCCGACGGGGAACTGAGCGAGCAGTAC
TCCAAGTCGGACGGGAGCCAGACGAGCGCAGTGGACCTGACGTGGAGCTACGCGTCGGCGCTGACGGCGTTCGCC
GCTGAGGCCGGGACATCGTACGGCAGCTGGGGCGCAGCGAACCTGTCGACATCGTCGTGCCCGAGCACGAGCGGC
GTGTCTGTGACGTTTGAGGTTGAGTACGACACGGAATATGGAGAGAATCTGTACATCACCGGGTCCGTTTCAGAA
TTGGAGGACTGGTCGGCCGACGACGCCCTGATCATGTCCTCCGCGAATTACCCGACATGGAGCATCACAGTGACC
TTGCCTGCGAGCACGGCCATCCAGTACAAGTATCTGACGAAGTACAACGGTGACGTCACCTGGGAGGACGACCCG
AACAACGAGATCACGACACCCGCGAGCGGAAGCGTGACGCAGTCGGATAGCTGGCATTGA
Gene >RhoplFPRL280|160_2
ATGCGTCTCACAGTCGTCTCTGGTCTTGCCTATGCGTGCGGAGCCCTCGCGGCGTCCAGCAGCGTCGGCTCGTAC
ATCGCTTCCGAGTCGCCGGTCGCGAAGGCCGGCGTGCTCGCCAACATCGGTGCGGGCGGCTCAAAGTCGTCTGGT
GCTTATGTACGCTGTTCAATTGCCGGTATTCCGCTCATGTGTGCTCATGAGCAATGATCCACAGTCCGGCGTTGT
GATCGCCAGTCCCAGCACGTCCAACCCGGACTACTTGTACACCTGGACGCGCGACTCGTCACTGACGTTCAAGGC
GCTCATCGACCAGTACACGTCCGGCGAGGACACCTCGCTGCGCACGCTCATCGACGAGTTCGTCTCCGCCGAGGC
GACCCTGCAGCAGGTCACGAACCCCAGCGGCAGCGTGAGCACCGGTGGGCTCGGCGAGCCGAAGTTCAACATCAA
TGAGACAGCATTCACTGGAGCCTGGGGCAGGCCGCAGCGCGGTATGTGTCTGCAGTGTATGGGCTGGGTGCGAGC
GATCCTCAATTTGCGCAGATGGCCCCGCTCTGCGTGCGACGGCCGTCATGTCGTACGCGACGTACCTATATAACA
GTGGAAACACGACGTATGTCACCGACACGCTCTGGCCCATCATTGAGCTCGACCTCAACTATGTTGCGGGTAACT
GGAACCAGTCAACGTACGTGTGATTTGTCAATTGTTTGTGAATTCAATGGCAACGAATATGACATTTGTCGCTGT
GTCGCTCCCATTATCGCCGCTGAAAGCTGCAGGCTCGTTTTCTTGTATTCTGGACTGACTTGCGTTCATACAGCT
TTGACTTATGGGAGGAAGTGGATTCGTCCTCGTTCTTCACTACCGCTGTTCAGCACCGTTCCCTTCGGCAAGGAA
TCATCTTCGCGAACTTGATCGGCCAAACCTCTGTAGTTTCCAACTACGAGACACAGGCCGAGGCTCTTCTGTGTT
TTCTGCAGGTAGGTACGTTGTTCGGTTCTATGCTAGGGTTCATGAAGTCACCGCCGAACAGTCATACTGGAATCC
TACTGACAATTACATGACCGCGAACACTGGCGGTGGACGCTCCGGTAAGGATGCCAACACCGTCTTGGCTTCGAT
TCACACATTCGACCTGGACGCCGGCTGCGACGCGACGACCTTCCAGCCGTGCTCGGACAAGGCGCTCTCGAACCT
CAAGGTCTATGTCGACTCGTTCCGGTCGATCTACGCCATCAATGATGACATCTCATCCGACGCAGCTGTCGCGAC
CGGGCGGTACCCCGAGGACACATACTACAATGGAAACGTGAGCATCAATGATACGTGCGGCGATCCTCTTTGACG
AACATGTGTCTAGCCGTGGTACCTATGCACGCTCGCCGTCGCTGAGCAGCTGTACGACGCGCTCATTGTGTGGGA
CGCACAGGACTACCTCGAGGTGACGAGCACGTCGCTCGCGTTCTTCCAGCAGTTCGACTCGTCTGTCGCCGCGGG
GACGTACGACTCAAGCACGAGCACGTACAGCACGCTCACGAGCGCGGTCAAGAGCTTCGCAGACGGCTTCACGCT
CATCGTCGCGAACTATACCCCGTCCGACGGGGAACTGAGCGAGCAGTACTCCAAGTCGGACGGGAGCCAGACGAG
CGCAGTGGACCTGACGTGGAGCTACGCGTCGGCGCTGACGGCGTTCGCCGCTGAGGCCGGGACATCGTACGGCAG
CTGGGGCGCAGCGAACCTGTCGACATCGTCGTGCCCGAGCACGAGCGGCGTGTCTGTGACGTTTGAGGTTGAGTA
CGACACGGAATATGGAGGTGAGGGGATGTTATGCGTCTTAGACACTGTTCTGCAGCTGACTATTCATTGTGACCA
GAGAATCTGTACATCACCGGGTCCGTTTCAGAATTGGAGGACTGGTCGGCCGACGACGCCCTGATCATGTCCTCC
GCGAATTACCCGACATGGAGCAGTATGTGCATGTCTGGCTGTTCTTGTCGTGCGTGATGGCTGACGACGCGGCGT
GCAGTCACAGTGACCTTGCCTGCGAGCACGGCCATCCAGTACAAGTATCTGACGAAGTACAACGGTGACGTCACC
TGGGAGGACGACCCGAACAACGAGATCACGACACCCGCGAGCGGAAGCGTGACGCAGTCGGATAGCTGGCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail