Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|150_6
Gene name
LocationNODE_150:10675..12819
Strand-
Gene length (bp)2144
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 8.8E-84 41 486
PF07690 MFS_1 Major Facilitator Superfamily 3.2E-23 67 374
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-08 314 483
PF13347 MFS_2 MFS/sugar transport protein 3.5E-07 76 155

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 75 97 22
3 106 125 19
4 130 152 22
5 286 308 22
6 323 345 22
7 352 372 20
8 387 409 22
9 422 440 18
10 450 472 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|150_6
MAVGATVTAKATTGVAHLLDPNRKWYNNRRLINLHAWIVLFIIISSANGFDGSLMNNFQSLWQWEGYFNSPSGSL
LGALSAMQNIGSLAAYPFAPYLSDGIGRRRTIFVGAVFTLVGVALQSAAQNIGMFIAGRFLIGFGVCFAANAAPM
LVTEISYPTYRAPLTSVYNSLWYSGNVIASWTTYGTAYIPNEWSWRIPSIIQGIPSILQFFFVLLAPESPRWLIS
NGKDAEGLKILAYYHADGNEQDPLVQFEFAEIKAAIDFDRTVNSDVGWKALYSTPGNRKRMIIAIAIGWFSQWSG
NGLVSYYLNKVFDTIGITSTSKQLLITGILAIWNLIISVSASFLVDRIGRRPLFLWATGGSLVFFTLQTICSAQY
ALHQQPAAAHSVIAFIFLYYAFYDLAYTPLIVTYTCEILPHSLRAKGLTVYSVGVSLALVFNQYVNPVALQRLAW
KYYIFYCCWIAFEFVFIYFMLVETKNRTLEETAALFDHKDLAQEIMPIIEAQQGKEKDIQSVSEKDIHSVLEKAS
EARVEIMMT*
Coding >RhoplFPRL280|150_6
ATGGCAGTCGGCGCCACGGTTACGGCAAAGGCGACGACGGGCGTCGCGCACCTCCTGGACCCGAATAGGAAGTGG
TACAACAATCGGCGACTCATTAATCTGCATGCTTGGATCGTCCTCTTCATCATCATATCTTCAGCCAATGGGTTT
GACGGGAGTCTGATGAACAACTTTCAGTCCCTCTGGCAATGGGAGGGCTACTTCAACAGTCCATCGGGGTCCCTC
CTGGGCGCGCTCAGCGCTATGCAAAACATTGGTTCTCTGGCCGCCTATCCGTTTGCGCCCTACTTGTCTGACGGA
ATAGGTCGTCGGCGCACAATCTTTGTCGGCGCAGTATTCACATTGGTGGGCGTGGCGCTCCAGTCTGCAGCGCAG
AACATAGGGATGTTCATTGCTGGACGCTTCCTGATTGGTTTTGGGGTGTGCTTTGCAGCGAACGCAGCGCCAATG
CTGGTCACTGAGATCTCATATCCGACCTACCGCGCACCTCTGACCTCTGTGTACAACTCGCTTTGGTATTCGGGT
AATGTCATTGCGTCATGGACGACATATGGGACTGCCTACATCCCGAATGAATGGTCGTGGCGCATCCCTTCCATC
ATCCAGGGTATCCCGTCGATTCTCCAATTCTTTTTCGTACTTCTTGCCCCGGAAAGCCCGCGTTGGCTAATTTCC
AATGGGAAGGATGCGGAAGGCCTGAAAATCTTGGCATATTACCATGCTGATGGCAACGAGCAGGATCCTCTTGTG
CAATTCGAGTTCGCCGAGATCAAGGCTGCGATTGACTTCGACCGAACTGTGAACAGCGATGTTGGATGGAAGGCT
CTGTATTCCACGCCGGGTAACAGGAAGCGGATGATCATAGCCATAGCAATTGGCTGGTTCTCGCAGTGGTCCGGG
AATGGACTTGTATCGTATTACCTGAACAAGGTCTTTGATACTATCGGCATTACGAGTACTTCGAAGCAGCTACTC
ATCACAGGGATCCTCGCAATTTGGAACCTCATCATATCTGTATCAGCCTCATTCCTCGTAGATCGCATCGGTCGT
CGTCCCCTCTTCCTTTGGGCAACGGGAGGCAGCCTCGTGTTCTTCACTCTTCAAACGATTTGTTCGGCGCAATAC
GCATTGCACCAACAACCCGCTGCGGCCCATTCGGTGATTGCGTTCATCTTCCTCTATTATGCCTTTTATGATTTG
GCATATACACCTCTCATTGTGACGTACACATGCGAGATCCTACCCCATTCGTTGCGGGCAAAGGGTCTCACGGTG
TATAGCGTTGGGGTCTCGCTCGCACTAGTGTTCAATCAGTACGTCAACCCTGTTGCTCTCCAGCGCCTTGCGTGG
AAGTACTATATCTTCTATTGCTGTTGGATTGCCTTCGAGTTTGTTTTCATCTACTTCATGCTCGTGGAGACGAAG
AATCGCACGCTGGAGGAGACGGCCGCCCTTTTCGACCACAAGGATCTTGCGCAGGAAATCATGCCAATCATTGAG
GCTCAGCAAGGCAAGGAGAAAGATATCCAGTCAGTATCGGAGAAAGATATCCATTCAGTATTGGAGAAAGCATCA
GAAGCAAGAGTGGAGATCATGATGACCTGA
Transcript >RhoplFPRL280|150_6
ATGGCAGTCGGCGCCACGGTTACGGCAAAGGCGACGACGGGCGTCGCGCACCTCCTGGACCCGAATAGGAAGTGG
TACAACAATCGGCGACTCATTAATCTGCATGCTTGGATCGTCCTCTTCATCATCATATCTTCAGCCAATGGGTTT
GACGGGAGTCTGATGAACAACTTTCAGTCCCTCTGGCAATGGGAGGGCTACTTCAACAGTCCATCGGGGTCCCTC
CTGGGCGCGCTCAGCGCTATGCAAAACATTGGTTCTCTGGCCGCCTATCCGTTTGCGCCCTACTTGTCTGACGGA
ATAGGTCGTCGGCGCACAATCTTTGTCGGCGCAGTATTCACATTGGTGGGCGTGGCGCTCCAGTCTGCAGCGCAG
AACATAGGGATGTTCATTGCTGGACGCTTCCTGATTGGTTTTGGGGTGTGCTTTGCAGCGAACGCAGCGCCAATG
CTGGTCACTGAGATCTCATATCCGACCTACCGCGCACCTCTGACCTCTGTGTACAACTCGCTTTGGTATTCGGGT
AATGTCATTGCGTCATGGACGACATATGGGACTGCCTACATCCCGAATGAATGGTCGTGGCGCATCCCTTCCATC
ATCCAGGGTATCCCGTCGATTCTCCAATTCTTTTTCGTACTTCTTGCCCCGGAAAGCCCGCGTTGGCTAATTTCC
AATGGGAAGGATGCGGAAGGCCTGAAAATCTTGGCATATTACCATGCTGATGGCAACGAGCAGGATCCTCTTGTG
CAATTCGAGTTCGCCGAGATCAAGGCTGCGATTGACTTCGACCGAACTGTGAACAGCGATGTTGGATGGAAGGCT
CTGTATTCCACGCCGGGTAACAGGAAGCGGATGATCATAGCCATAGCAATTGGCTGGTTCTCGCAGTGGTCCGGG
AATGGACTTGTATCGTATTACCTGAACAAGGTCTTTGATACTATCGGCATTACGAGTACTTCGAAGCAGCTACTC
ATCACAGGGATCCTCGCAATTTGGAACCTCATCATATCTGTATCAGCCTCATTCCTCGTAGATCGCATCGGTCGT
CGTCCCCTCTTCCTTTGGGCAACGGGAGGCAGCCTCGTGTTCTTCACTCTTCAAACGATTTGTTCGGCGCAATAC
GCATTGCACCAACAACCCGCTGCGGCCCATTCGGTGATTGCGTTCATCTTCCTCTATTATGCCTTTTATGATTTG
GCATATACACCTCTCATTGTGACGTACACATGCGAGATCCTACCCCATTCGTTGCGGGCAAAGGGTCTCACGGTG
TATAGCGTTGGGGTCTCGCTCGCACTAGTGTTCAATCAGTACGTCAACCCTGTTGCTCTCCAGCGCCTTGCGTGG
AAGTACTATATCTTCTATTGCTGTTGGATTGCCTTCGAGTTTGTTTTCATCTACTTCATGCTCGTGGAGACGAAG
AATCGCACGCTGGAGGAGACGGCCGCCCTTTTCGACCACAAGGATCTTGCGCAGGAAATCATGCCAATCATTGAG
GCTCAGCAAGGCAAGGAGAAAGATATCCAGTCAGTATCGGAGAAAGATATCCATTCAGTATTGGAGAAAGCATCA
GAAGCAAGAGTGGAGATCATGATGACCTGA
Gene >RhoplFPRL280|150_6
ATGGCAGTCGGCGCCACGGTTACGGCAAAGGCGACGACGGGCGTCGCGCACCTCCTGGACCCGAATAGGAAGTGG
TACAACAATCGGCGGTGCGTGGCTCGGTATCATTCAGCGTGATCATCTACTGAACTGCGTCTCTTCTCGAAGACT
CATTAATCTGCATGCTTGGATCGTCCTCTTGTACGTTTGGCGCGATGCGGCTTTAGATAGCTTCGGAACACTCAT
GAGGGGCTCGTCTCAGCATCATCATATCTTCAGCCAATGGGTTTGACGGGAGTCTGATGAACAACTTTCAGTCCC
TCTGGCAATGGGAGGGCTACTTCAACAGTCCATCGGGGTCCCTCCTGGGCGCGCTCAGCGCTATGCAAGTTTAGT
TCATTTCTACAAAATATCACGATACAAGAGATTGAGGGATACTCCAGAACATTGGTTCTCTGGCCGCCTATCCGT
TTGCGCCCTACTTGTCTGACGGAATAGGTCGTCGGCGCACAATCTTTGTCGGCGCAGTATTCACATTGGTGGGCG
TGGCGCTCCAGTCTGCAGCGCAGAACATAGGGATGTTCATTGCTGGACGGTGAGCGGAGTGTAACGTGACCTACG
TGTCGTCTGACATGCTGCTATAGCTTCCTGATTGGTTTTGGGGTGTGCTTTGCAGGTCTGATATCGAGTAATAGC
CATCTGAGGACTTACTAATATCCTGTGCAGCGAACGCAGCGCCAATGCTGGTCACTGAGATCTCATATCCGACCT
ACCGCGCACCTCTGACCTCTGTGTACAACTCGCTTTGGTATTCGGGTAATGTCATGTACGTGCGATCACGATGGC
TGGATGCTCGTTTCTGATATGCATATAGTGCGTCATGGACGACATATGGGACTGCCTACATCCCGAATGAATGGT
CGTGGCGCATCCCTTCCATCATCCAGGGTATCCCGTCGATTCTCCAATTCTTTTTCGTACTTCTTGCCCCGGAAA
GCCCGCGTTGGCTAATTTCCAATGGGAAGGATGCGGAAGGCCTGAAAATCTTGGCATATTACCATGCTGATGGCA
ACGAGCAGGATCCTCTTGTGCAATTCGAGTTCGCCGAGATCAAGGCTGCGATTGACTTCGACCGAACTGGTGCTT
CCGCATATATTTTCACACACTCTGACGTTTTCTGATAGAATGGCACAGTGAACAGCGATGTTGGATGGAAGGCTC
TGTATTCCACGCCGGGTAACAGGAAGCGGATGATCATAGCCATAGCAATTGGCTGGTTCTCGCAGTGGTCCGGGA
ATGGACTTGTATCGTATTACCTGAACAAGGTCTTTGATACTATCGGCATTACGAGTACTTCGAAGCAGCTACTCA
TCACAGGGTCGGTTTCCCGCCAGCTTGTCTTTCGGTCTCTGACGTGTTCACAGGATCCTCGCAATTTGGAACCTC
ATCATATCTGTATCAGCCTCATTCCTCGTAGATCGCATCGGTCGTCGTCCCCTCTTCCTTTGGGCAACGGGAGGC
AGCCTCGTGTTCTTCACTCTTCAAACGATTTGTTCGGCGCAATACGCATTGCACCAACAACCCGCTGCGGCCCAT
TCGGTGATTGCGTTCATCTTCCTCTATTATGCCTTTTATGAGTAAGTGTTGCTTCTGCCGGTCGCGAGTGAGTAG
CTGATCAGTTACGCCCTGTCAACAGTTTGGCATATACACCTCTCATTGTGACGTACACATGCGAGATCCTACCCC
ATTCGTTGCGGGCAAAGGGTCTCACGGTGTATAGCGTTGGGGTCTCGCTCGCACTAGTGTTCAATCAGTACGTCA
ACCCTGTTGCTCTCCAGCGCCTTGCGTGGAAGTACTATGTAAGCTTCTTGTCTACGTTCACGTTTCTAGTCCATC
AGTCTGATATCTGATACACACAGATCTTCTATTGCTGTTGGATTGCCTTCGAGTTTGTTTTCATCTACTTCATGC
TCGTGGAGACGAAGAATCGCACGCTGGAGGAGACGGCCGCCCTTTTCGACCACAAGGATCTTGCGCAGGAAATCA
TGCCAATCATTGAGGCTCAGCAAGGCAAGGAGAAAGATATCCAGTCAGTATCGGAGAAAGATATCCATTCAGTAT
TGGAGAAAGCATCAGAAGCAAGAGTGGAGATCATGATGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail