Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|150_1
Gene name
LocationNODE_150:5444..9368
Strand+
Gene length (bp)3924
Transcript length (bp)3096
Coding sequence length (bp)3096
Protein length (aa) 1032

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.0E-30 23 360
PF07993 NAD_binding_4 Male sterility protein 1.2E-28 659 891
PF01370 Epimerase NAD dependent epimerase/dehydratase family 4.0E-09 657 893

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 4 NRPS-like

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup44
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|020370
Agaricus bisporus var bisporus H39 AgabiH39|022990
Agaricus bisporus var bisporus H39 AgabiH39|051590
Agaricus bisporus var bisporus H39 AgabiH39|109980
Agaricus bisporus var bisporus H39 AgabiH39|271800
Agaricus bisporus var bisporus H97 AgabiH97|020370
Agaricus bisporus var bisporus H97 AgabiH97|022990
Agaricus bisporus var bisporus H97 AgabiH97|051370
Agaricus bisporus var bisporus H97 AgabiH97|051590
Agaricus bisporus var bisporus H97 AgabiH97|109980
Rhodonia placenta FPRL280 RhoplFPRL280|583_3
Rhodonia placenta FPRL280 RhoplFPRL280|465_2
Rhodonia placenta FPRL280 RhoplFPRL280|465_1
Rhodonia placenta FPRL280 RhoplFPRL280|210_1
Rhodonia placenta FPRL280 RhoplFPRL280|103_1
Rhodonia placenta FPRL280 RhoplFPRL280|150_1 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|117_1
Rhodonia placenta FPRL280 RhoplFPRL280|103_4
Rhodonia placenta FPRL280 RhoplFPRL280|86_1
Rhodonia placenta FPRL280 RhoplFPRL280|168_2
Rhodonia placenta FPRL280 RhoplFPRL280|93_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|150_1
MSDMTTPPLDGSVQVLPGFLDFHARQHPRQPLYVFSASDNPHGDLSNISYQDFSDATHRIAHYLRPIPGEDLDRR
VLACLLHTDAVFYHAVTVGAIRAGLIPFPIAPGTSPAAIARMLERTNTHRIISQPHFASLVRDIQRVLPDDYDLH
VDPLPSFTEVFQSFGDLLDAKTNGIELYPPADYPIDSEDVILYLHSSGSTGFPKPIPQTGATLLNWILSPTNREP
AELGYIWGPMMLPPFHTLGITTQLVYPLGSAKPAVLFTPRAHLGVAPLIPTPELTLDAVRQTKVDVLVVVPSVLE
AWVQDKESMVVLNTIKAVIYCGGPLSPATGDRLVAAGVRLYCVYGGTEFGGVTHILDADYDHIGVAPKSPDEWQW
MRFSDRCSVRWVPQDDGTYECCFMASQTHRPAIENMADGEHGYATSDLFIPHPVKPGLWRIVSRSDDVITLSTGE
KIVPIQQQDIVSAHPLVKGNIMFGRGREQVGILIEPRPDHTIIPGHDHVLAEFRNMLWPQIEEANRIAPAHARIY
KEMILVTDSARPLIRAAKGTIVVKQSLALYEEDINNLLSATLLRNHIMAALRASSDSQIKSAARDVQPNFVFTHP
TILLLATAISALANPNRAAPAARSPVNQIETMIEKYTASLTPVSASQAEQQTAAAVVLITGSTGALGSYMVAELL
ADIRVARVYALNRGTSLQERQAAAFKAAGFSANIMSDVRLKLLSGDMTRDDFGLEAKTLDELRTSVTHVIHNAWR
VDFNLALASFEPQIGATMRLLNLVPRARFSFVSSMSAAQSWDTTERGLYVPEEPLHDPSIAVGTGYGMSKFVVEE
VLANARKLGYSTTSLRVGQICGSRRNGSWNTSEWVPSLVKSSISLGCLPDGNGVVSWIPIEAVARAAVDISLSVN
APTLVNIVHPHPTPARHVFGAIKEALESDVSLSVVPIQEWVDKLEVIAQGASESELSTIPAIKLLDFFRSIATLT
GRMQDTYAANAEMGGLPLYETTKARALCSALNELCPLAEEDAQKWVLFWREWRFIP*
Coding >RhoplFPRL280|150_1
ATGTCCGACATGACGACACCTCCACTGGACGGTTCGGTTCAAGTGTTACCGGGATTTCTCGACTTTCATGCCAGA
CAACATCCTCGGCAGCCACTTTACGTGTTTTCTGCATCAGACAATCCTCACGGCGACCTGTCAAACATATCATAT
CAGGACTTCAGTGATGCTACACACCGCATTGCTCACTATTTGCGTCCGATACCAGGCGAAGACCTTGACCGTCGA
GTCCTCGCATGCCTTTTGCATACTGATGCCGTCTTCTACCACGCTGTTACTGTGGGCGCCATTCGCGCGGGATTG
ATTCCCTTCCCTATAGCGCCTGGTACCTCTCCTGCTGCCATTGCCAGAATGCTGGAGCGCACAAATACGCATCGC
ATTATCTCCCAGCCTCACTTTGCTTCGTTGGTGCGCGACATTCAGCGCGTTCTCCCCGACGACTATGATCTCCAC
GTGGACCCGTTACCCTCCTTTACGGAAGTCTTCCAGAGCTTCGGTGATCTCCTCGATGCGAAGACGAATGGCATT
GAGCTATACCCCCCAGCTGACTACCCAATTGACTCCGAAGACGTTATCCTGTATCTGCACTCATCAGGCTCGACA
GGCTTTCCGAAGCCCATTCCGCAAACTGGTGCGACCCTCCTGAATTGGATACTGTCGCCGACGAACAGGGAACCT
GCAGAATTGGGCTACATCTGGGGTCCAATGATGTTGCCGCCGTTCCATACCCTCGGCATCACTACACAACTTGTG
TATCCACTTGGTTCGGCCAAGCCGGCAGTTTTGTTCACCCCACGCGCGCATCTTGGCGTAGCGCCATTGATACCT
ACACCAGAACTTACGCTTGATGCCGTGCGCCAGACGAAGGTAGACGTACTGGTTGTAGTACCCTCGGTTTTAGAA
GCGTGGGTTCAAGACAAGGAAAGTATGGTTGTGCTGAATACGATCAAAGCTGTGATTTACTGCGGCGGGCCCCTA
TCGCCTGCCACCGGCGACAGACTCGTTGCTGCTGGTGTCCGCCTCTATTGCGTGTACGGAGGTACCGAGTTTGGC
GGCGTAACACATATCCTTGACGCCGACTATGATCATATCGGAGTCGCACCCAAATCTCCGGATGAGTGGCAATGG
ATGCGTTTCTCTGATAGATGCAGTGTGCGCTGGGTACCTCAGGACGACGGAACTTATGAATGTTGCTTCATGGCA
AGTCAGACACATCGTCCAGCTATAGAGAACATGGCGGATGGCGAACATGGTTATGCGACTTCTGATCTCTTCATA
CCACATCCCGTGAAGCCTGGCCTTTGGCGGATAGTGAGCAGATCGGATGATGTGATCACGCTCTCGACCGGGGAG
AAGATTGTCCCTATTCAGCAGCAGGACATAGTATCAGCTCATCCGCTCGTGAAAGGCAACATAATGTTTGGTCGC
GGTCGCGAACAAGTTGGCATCCTTATCGAGCCGCGTCCCGACCATACTATCATACCAGGGCATGATCATGTACTC
GCGGAATTCCGCAATATGCTCTGGCCTCAGATCGAAGAAGCGAATCGAATCGCACCCGCACATGCGCGCATTTAC
AAGGAGATGATTCTGGTGACTGATTCTGCCCGGCCTCTTATTCGCGCAGCCAAAGGAACCATCGTAGTCAAGCAG
TCCCTCGCACTATATGAAGAAGATATCAACAATCTCTTGTCTGCGACTTTACTGAGGAATCATATAATGGCTGCG
CTGCGGGCTTCCTCAGACTCACAGATCAAGAGCGCAGCACGCGACGTGCAGCCTAATTTCGTATTCACCCATCCT
ACAATCCTGTTGCTTGCCACCGCAATTTCAGCCCTAGCGAATCCGAACCGCGCCGCCCCAGCCGCGCGTTCCCCT
GTCAATCAAATTGAGACTATGATCGAAAAGTATACTGCGTCGTTGACGCCGGTGTCTGCATCTCAGGCGGAGCAG
CAAACGGCCGCTGCGGTGGTCCTCATAACGGGGTCGACGGGCGCTCTGGGCTCATACATGGTTGCCGAACTGCTC
GCTGATATACGCGTCGCTCGAGTGTATGCCTTAAATCGTGGCACCTCTCTGCAAGAGCGACAAGCAGCAGCTTTC
AAAGCGGCGGGATTTTCTGCGAACATAATGTCCGACGTCCGGCTCAAGCTGTTGAGTGGCGATATGACGAGGGAC
GATTTTGGCCTAGAAGCAAAGACCTTGGATGAACTGCGCACGTCCGTGACTCATGTCATCCACAATGCATGGCGG
GTGGACTTCAACCTCGCCCTCGCATCTTTTGAGCCACAAATCGGAGCGACAATGAGGCTGCTAAATCTCGTACCA
CGCGCTCGCTTCTCGTTCGTATCCTCTATGTCAGCCGCACAGAGCTGGGATACCACTGAGCGTGGACTGTATGTT
CCTGAGGAACCGCTGCATGATCCATCGATTGCCGTCGGCACTGGCTACGGCATGTCGAAGTTTGTAGTCGAAGAG
GTTCTAGCCAATGCACGCAAGTTAGGTTACTCCACCACGAGTCTCCGAGTCGGCCAGATATGCGGGTCCAGACGC
AATGGTAGTTGGAACACATCGGAGTGGGTTCCGAGCCTGGTCAAGTCGAGTATCTCTCTTGGGTGTCTACCAGAT
GGCAACGGGGTGGTTTCGTGGATCCCGATAGAAGCTGTTGCACGTGCGGCTGTGGACATATCACTATCAGTGAAC
GCACCCACCTTGGTAAACATTGTCCATCCGCATCCTACACCTGCGCGGCATGTATTTGGCGCGATCAAGGAAGCA
TTGGAATCAGACGTCTCGTTGTCCGTCGTCCCGATACAAGAGTGGGTGGATAAACTGGAAGTCATTGCACAAGGC
GCTTCGGAGAGTGAACTGTCTACAATACCCGCGATCAAGCTGCTTGATTTCTTCCGCAGTATTGCTACACTTACC
GGACGAATGCAAGATACATACGCTGCCAATGCAGAGATGGGTGGGTTACCGTTGTACGAGACGACGAAGGCGCGA
GCACTCTGCTCCGCGCTAAACGAGCTTTGTCCCCTAGCAGAAGAAGACGCCCAGAAGTGGGTCTTGTTTTGGAGA
GAATGGCGGTTCATCCCATGA
Transcript >RhoplFPRL280|150_1
ATGTCCGACATGACGACACCTCCACTGGACGGTTCGGTTCAAGTGTTACCGGGATTTCTCGACTTTCATGCCAGA
CAACATCCTCGGCAGCCACTTTACGTGTTTTCTGCATCAGACAATCCTCACGGCGACCTGTCAAACATATCATAT
CAGGACTTCAGTGATGCTACACACCGCATTGCTCACTATTTGCGTCCGATACCAGGCGAAGACCTTGACCGTCGA
GTCCTCGCATGCCTTTTGCATACTGATGCCGTCTTCTACCACGCTGTTACTGTGGGCGCCATTCGCGCGGGATTG
ATTCCCTTCCCTATAGCGCCTGGTACCTCTCCTGCTGCCATTGCCAGAATGCTGGAGCGCACAAATACGCATCGC
ATTATCTCCCAGCCTCACTTTGCTTCGTTGGTGCGCGACATTCAGCGCGTTCTCCCCGACGACTATGATCTCCAC
GTGGACCCGTTACCCTCCTTTACGGAAGTCTTCCAGAGCTTCGGTGATCTCCTCGATGCGAAGACGAATGGCATT
GAGCTATACCCCCCAGCTGACTACCCAATTGACTCCGAAGACGTTATCCTGTATCTGCACTCATCAGGCTCGACA
GGCTTTCCGAAGCCCATTCCGCAAACTGGTGCGACCCTCCTGAATTGGATACTGTCGCCGACGAACAGGGAACCT
GCAGAATTGGGCTACATCTGGGGTCCAATGATGTTGCCGCCGTTCCATACCCTCGGCATCACTACACAACTTGTG
TATCCACTTGGTTCGGCCAAGCCGGCAGTTTTGTTCACCCCACGCGCGCATCTTGGCGTAGCGCCATTGATACCT
ACACCAGAACTTACGCTTGATGCCGTGCGCCAGACGAAGGTAGACGTACTGGTTGTAGTACCCTCGGTTTTAGAA
GCGTGGGTTCAAGACAAGGAAAGTATGGTTGTGCTGAATACGATCAAAGCTGTGATTTACTGCGGCGGGCCCCTA
TCGCCTGCCACCGGCGACAGACTCGTTGCTGCTGGTGTCCGCCTCTATTGCGTGTACGGAGGTACCGAGTTTGGC
GGCGTAACACATATCCTTGACGCCGACTATGATCATATCGGAGTCGCACCCAAATCTCCGGATGAGTGGCAATGG
ATGCGTTTCTCTGATAGATGCAGTGTGCGCTGGGTACCTCAGGACGACGGAACTTATGAATGTTGCTTCATGGCA
AGTCAGACACATCGTCCAGCTATAGAGAACATGGCGGATGGCGAACATGGTTATGCGACTTCTGATCTCTTCATA
CCACATCCCGTGAAGCCTGGCCTTTGGCGGATAGTGAGCAGATCGGATGATGTGATCACGCTCTCGACCGGGGAG
AAGATTGTCCCTATTCAGCAGCAGGACATAGTATCAGCTCATCCGCTCGTGAAAGGCAACATAATGTTTGGTCGC
GGTCGCGAACAAGTTGGCATCCTTATCGAGCCGCGTCCCGACCATACTATCATACCAGGGCATGATCATGTACTC
GCGGAATTCCGCAATATGCTCTGGCCTCAGATCGAAGAAGCGAATCGAATCGCACCCGCACATGCGCGCATTTAC
AAGGAGATGATTCTGGTGACTGATTCTGCCCGGCCTCTTATTCGCGCAGCCAAAGGAACCATCGTAGTCAAGCAG
TCCCTCGCACTATATGAAGAAGATATCAACAATCTCTTGTCTGCGACTTTACTGAGGAATCATATAATGGCTGCG
CTGCGGGCTTCCTCAGACTCACAGATCAAGAGCGCAGCACGCGACGTGCAGCCTAATTTCGTATTCACCCATCCT
ACAATCCTGTTGCTTGCCACCGCAATTTCAGCCCTAGCGAATCCGAACCGCGCCGCCCCAGCCGCGCGTTCCCCT
GTCAATCAAATTGAGACTATGATCGAAAAGTATACTGCGTCGTTGACGCCGGTGTCTGCATCTCAGGCGGAGCAG
CAAACGGCCGCTGCGGTGGTCCTCATAACGGGGTCGACGGGCGCTCTGGGCTCATACATGGTTGCCGAACTGCTC
GCTGATATACGCGTCGCTCGAGTGTATGCCTTAAATCGTGGCACCTCTCTGCAAGAGCGACAAGCAGCAGCTTTC
AAAGCGGCGGGATTTTCTGCGAACATAATGTCCGACGTCCGGCTCAAGCTGTTGAGTGGCGATATGACGAGGGAC
GATTTTGGCCTAGAAGCAAAGACCTTGGATGAACTGCGCACGTCCGTGACTCATGTCATCCACAATGCATGGCGG
GTGGACTTCAACCTCGCCCTCGCATCTTTTGAGCCACAAATCGGAGCGACAATGAGGCTGCTAAATCTCGTACCA
CGCGCTCGCTTCTCGTTCGTATCCTCTATGTCAGCCGCACAGAGCTGGGATACCACTGAGCGTGGACTGTATGTT
CCTGAGGAACCGCTGCATGATCCATCGATTGCCGTCGGCACTGGCTACGGCATGTCGAAGTTTGTAGTCGAAGAG
GTTCTAGCCAATGCACGCAAGTTAGGTTACTCCACCACGAGTCTCCGAGTCGGCCAGATATGCGGGTCCAGACGC
AATGGTAGTTGGAACACATCGGAGTGGGTTCCGAGCCTGGTCAAGTCGAGTATCTCTCTTGGGTGTCTACCAGAT
GGCAACGGGGTGGTTTCGTGGATCCCGATAGAAGCTGTTGCACGTGCGGCTGTGGACATATCACTATCAGTGAAC
GCACCCACCTTGGTAAACATTGTCCATCCGCATCCTACACCTGCGCGGCATGTATTTGGCGCGATCAAGGAAGCA
TTGGAATCAGACGTCTCGTTGTCCGTCGTCCCGATACAAGAGTGGGTGGATAAACTGGAAGTCATTGCACAAGGC
GCTTCGGAGAGTGAACTGTCTACAATACCCGCGATCAAGCTGCTTGATTTCTTCCGCAGTATTGCTACACTTACC
GGACGAATGCAAGATACATACGCTGCCAATGCAGAGATGGGTGGGTTACCGTTGTACGAGACGACGAAGGCGCGA
GCACTCTGCTCCGCGCTAAACGAGCTTTGTCCCCTAGCAGAAGAAGACGCCCAGAAGTGGGTCTTGTTTTGGAGA
GAATGGCGGTTCATCCCATGA
Gene >RhoplFPRL280|150_1
ATGTCCGACATGACGACACCTCCACTGGACGGTTCGGTTCAAGTGTTACCGGGATTTCTCGACTTTCATGCCAGA
CAACATCCTCGGCAGCCACTTTACGTGTTTTCTGCATCAGACAATCCTCACGGCGACCTGTCAAACATATCATAT
CAGGACTTCAGTGATGCTACACACCGCATTGCTCACTATTTGCGTCCGATACCAGGCGAAGACCTTGACCGTCGA
GTCCTCGCATGCCTTTTGCATACTGATGCCGTCTTCTACCACGCTGTTACTGTGGGCGCCATTCGCGCGGGATTG
ATTCCCTTCCCTATAGCGCCTGGTACCTCTCCTGCTGCCATTGCCAGAATGCTGGAGCGCACAAATACGCATCGC
ATTATCTCCCAGCCTCACTTTGCTTCGTTGGTGCGCGACATTCAGCGCGTTCTCCCCGACGACTATGATCTCCAC
GTGGACCCGTTACCCTCCTTTACGGAAGTCTTCCAGAGCTTCGGTGATCTCCTCGATGCGAAGACGAATGGCATT
GAGCTATACCCCCCAGCTGACTACCCAATTGACTCCGAAGACGTTATCCTGTATCTGCACTCATCAGGCTCGACA
GGCTTTCCGAAGCCCATTCCGCAAACTGGTGCGACCCTCCTGAATTGGATACTGTCGCCGACGAACAGGGAACCT
GCAGAATTGGGCTACATCTGGGGTCCAATGATGTTGCCGCCGTTCCATACCCTCGGCATCACTACACAACTTGTG
TATCCACTTGGTTCGGCCAAGCCGGCAGTTTTGTTCACCCCACGCGCGCATCTTGGCGTAGCGCCATTGATACCT
ACACCAGAACTTACGCTTGATGCCGTGCGCCAGACGAAGGTAGACGTACTGGTTGTAGTACCCTCGGTTTTAGAA
GTGAGTTTTGCTGGTTCGTGCTTTCGTGGTGGAATCTGACATCGTGTCCTCAAGGCGTGGGTTCAAGACAAGGAA
AGTATGGTTGTGCTGAATACGATCAAAGCTGTGGTAAGCACGCTTGCTTGAGGTATACACAGGTCTGTGATATTC
CTTGTCAGATTTACTGCGGCGGGCCCCTATCGCCTGCCACCGGCGACAGACTCGTTGCTGCTGGTGTCCGCCTCT
ATTGCGTGTACGGAGGTACCGAGTTTGGCGGCGTAACACATATCCTTGACGCCGACTATGATCATATCGGAGTCG
CACCCAAATCTCCGGATGAGTGGCAATGGATGCGTTTCTCTGATAGATGCAGTGTGCGCTGGGTACCTCAGGACG
ACGGAACTTATGAATGTTGCTTCATGGTAGGTTTTCCCGACCATGCCTGTGACACAGCCTGATCCACTTTCATTT
TCACGGCGCAGGCAAGTCAGACACATCGTCCAGCTATAGAGAACATGGCGGATGGCGAACATGGTTATGCGACTT
CTGATCTCTTCATACCACATCCCGTGAAGCCTGGCCTTTGGCGGATGTAAGTTTCTGTCACTTTTGGCGCTGCAT
CATGTCTACGCAGTACCTGATCTTCTGACGATTGCGTAGAGTGAGCAGATCGGATGATGTGATCACGCTCTCGAC
CGGTACGTCGTATTGTCCGAATACATTCCCCGATTCTCACACAATGAAAGGGGAGAAGATTGTCCCTATTCAGCA
GCAGGACATAGTATCAGCTCATCCGCTCGTGAAAGGCAACATAATGTTTGGTCGCGGTCGCGAACAAGTTGGCAT
CCTTATCGAGCCGCGTCCCGACCATACTATCATACCAGGGCATGATCATGTACTCGCGGAATTCCGCAATATGCT
CTGGTACCCTAATAGCGTCTTGCCGCTGCTGTCACTGATGTACATGTTTGTCCAGGCCTCAGATCGAAGAAGCGA
ATCGAATCGCACCCGCACATGCGCGCATTTACAAGGAGATGATTCTGGTGACTGATTCTGCCCGGCCTCTTATTC
GCGCAGCCAAAGGAACCATCGTAGTCAAGCAGTCCCTCGCACTATATGAAGAAGATATCAACAATCTGTCTGTTG
CTTCGCGTTGTGATCTTCGTCGCGAGCGCTGATGATCACCCACGCCAGGTATTCAAGAATAAAGGATAGTATGAA
TTTGCACGACATAGAATTACCCCATTCGTGGTCTGTTTCAGATCTACAGGAGTGGTTATTGAGGGCTGTTACAGC
CATCTCCATCGGGAAGACCTTGGATATTACTGATGATTTCTTTGAGCGAGGTTTCGATAGGTAAGCGTTCGCATA
CGAGCTGGTGCTAAACATGTGCACTGAGTCAATTCCAATGGCGTGTAGCTTGTCTGCGACTTTACTGAGGAATCA
TATAATGGCTGCGCTGCGGGCTTCCTCAGACTCACAGATCAAGAGCGCAGCACGCGACGTGCAGCCTAATTTCGT
ATTCACCCATCCTACAATCCTGTTGCTTGCCACCGCAATTTCAGCCCTAGCGAATCCGAACCGCGCCGCCCCAGC
CGCGCGTTCCCCTGTCAATCAAATTGAGACTATGATCGAAAAGTATACTGCGTCGTTGACGCCGGTGTCTGCATC
TCAGGCGGAGCAGCAAACGGCCGCTGCGGTGGTCCTCATAACGGGGTCGACGGGCGCTCTGGGCTCATACATGGT
TGCCGAACTGCTCGCTGATATACGCGTCGCTCGAGTGTATGCCTTAAATCGTGGCACCTCTCTGCAAGAGCGACA
AGCAGCAGCTTTCAAAGCGGCGGGATTTTCTGCGAACATAATGTCCGACGTCCGGCTCAAGCTGTTGAGTGGCGA
TATGACGAGGGACGATTTTGGCCTAGAAGCAAAGACCTTGGATGAAGTAACGTACTTCGTTTTGCGACAGAGTTG
TATGGCAACTGACCGCCATATAGCTGCGCACGTCCGTGACTCATGTCATCCACAATGCATGGCGGGTGGACTTCA
ACCTCGCCCTCGCATCTTTTGAGCCACAAATCGGAGCGACAATGAGGCTGCTAAATCTCGTACCACGCGCTCGCT
TCTCGTTCGTATCCTCTATGTCAGCCGCACAGAGCTGGGATACCACTGAGCGTGGACTGTATGTTCCTGAGGAAC
CGCTGCATGATCCATCGATTGCCGTCGGCACTGGCTACGGCATGTCGAAGTTTGTAGTCGAAGAGGTGCTATAAC
TGCTTGGCTTAGCGGACACTTGTGCTGACATCTATGCAAGGTTCTAGCCAATGCACGCAAGTTAGGTTACTCCAC
CACGAGTCTCCGAGTCGGCCAGATATGCGGGTCCAGACGCAATGGTAGTTGGAACACATCGGAGTGGGTTCCGAG
CCTGGTCAAGTCGAGTATCTCTCTTGGGTGTCTACCAGATGGCAACGGGGTAATATCTCAGCATCCTTCTCGCGA
TACTCCACTGACGACATACCGGGTTAGGTGGTTTCGTGGATCCCGATAGAAGCTGTTGCACGTGCGGCTGTGGAC
ATATCACTATCAGTGAACGCACCCACCTTGGTAAACATTGTCCATCCGCATCCTACACCTGCGCGGCATGTATTT
GGCGCGATCAAGGAAGCATTGGAATCAGACGTCTCGTTGTCCGTCGTCCCGATACAAGAGTGGGTGGATAAACTG
GAAGTCATTGCACAAGGCGCTTCGGAGAGTGAACTGTCTACAATAGTAAGTTGGCGTGAAGATATACAACAGGCG
TTGTTGCTGATATGTACGATGACCTTCCAGCCCGCGATCAAGCTGCTTGATTTCTTCCGCAGTATTGCTACACTT
ACCGGACGAATGCAAGATACATACGCTGCCAATGCAGAGATGGGTGGGTTACCGTTGTACGAGACGACGAAGGCG
CGAGCACTCTGCTCCGCGCTAAACGAGCTTTGTCCCCTAGCAGAAGAAGACGCCCAGAAGTGGGTCTTGTTTTGG
AGAGAATGGCGGTTCATCCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail