Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|148_12
Gene name
LocationNODE_148:10428..11200
Strand+
Gene length (bp)772
Transcript length (bp)570
Coding sequence length (bp)570
Protein length (aa) 190

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10342 Kre9_KNH Kre9/KNH-like N-terminal Ig-like domain 2.4E-05 34 119

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999771

Transmembrane Domains

Domain # Start End Length
1 166 188 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup3401
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016860
Agaricus bisporus var bisporus H97 AgabiH97|016860
Rhodonia placenta FPRL280 RhoplFPRL280|148_12 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|148_12
MKFASPALALAAFVTSAAAQLTILSPGGPDLWWVAQSQNTVIWTCDTSPYSTFTVLIDNSDPKILTSELAIIAQQ
ENFDCSETISQYQVTMPAASGYTLIFANPLNNTDVYAQTQPFEIKALGATYPAASATPTGGSSATVSGSSSAAAS
GASASSTAATSSKKNAAGRVAAPVVALAALAAAAGIAFA*
Coding >RhoplFPRL280|148_12
ATGAAGTTCGCCAGCCCAGCCCTCGCCCTCGCCGCCTTCGTGACCAGCGCGGCCGCTCAGCTCACGATCCTGAGC
CCTGGAGGTCCTGACTTGTGGTGGGTCGCACAGTCGCAGAACACCGTCATCTGGACATGCGACACCTCGCCCTAC
AGCACCTTCACTGTCTTGATCGACAACTCTGACCCGAAGATTCTGACCTCCGAGCTTGCTATCATCGCGCAGCAG
GAGAATTTCGATTGCTCCGAGACCATCTCGCAGTACCAGGTCACCATGCCTGCTGCGAGCGGTTATACCCTCATC
TTCGCTAACCCCTTGAACAACACTGACGTCTACGCCCAAACACAGCCCTTCGAGATCAAGGCCCTCGGTGCGACC
TACCCGGCTGCCTCTGCTACACCCACAGGAGGTTCGAGCGCGACCGTCAGCGGTAGCAGCAGTGCAGCGGCTTCT
GGCGCGTCTGCATCGTCTACCGCCGCGACCTCTAGCAAGAAGAATGCCGCGGGCCGTGTCGCCGCCCCAGTTGTA
GCCCTCGCTGCCCTTGCGGCTGCCGCCGGTATCGCCTTCGCGTGA
Transcript >RhoplFPRL280|148_12
ATGAAGTTCGCCAGCCCAGCCCTCGCCCTCGCCGCCTTCGTGACCAGCGCGGCCGCTCAGCTCACGATCCTGAGC
CCTGGAGGTCCTGACTTGTGGTGGGTCGCACAGTCGCAGAACACCGTCATCTGGACATGCGACACCTCGCCCTAC
AGCACCTTCACTGTCTTGATCGACAACTCTGACCCGAAGATTCTGACCTCCGAGCTTGCTATCATCGCGCAGCAG
GAGAATTTCGATTGCTCCGAGACCATCTCGCAGTACCAGGTCACCATGCCTGCTGCGAGCGGTTATACCCTCATC
TTCGCTAACCCCTTGAACAACACTGACGTCTACGCCCAAACACAGCCCTTCGAGATCAAGGCCCTCGGTGCGACC
TACCCGGCTGCCTCTGCTACACCCACAGGAGGTTCGAGCGCGACCGTCAGCGGTAGCAGCAGTGCAGCGGCTTCT
GGCGCGTCTGCATCGTCTACCGCCGCGACCTCTAGCAAGAAGAATGCCGCGGGCCGTGTCGCCGCCCCAGTTGTA
GCCCTCGCTGCCCTTGCGGCTGCCGCCGGTATCGCCTTCGCGTGA
Gene >RhoplFPRL280|148_12
ATGAAGTTCGCCAGCCCAGCCCTCGCCCTCGCCGCCTTCGTGACCAGCGCGGCCGCTCAGCTCACGATCCTGAGC
CCTGGAGGTCCTGACTTGTGGTGGGGTGCGTGTCGTTATCGCCTTGGCCTTCGCCAGCCGTCAATTCACTCAAAT
GTTTTTACACAGTCGCACAGTCGCAGAACACCGTCATCTGGACATGCGACACCTCGCCCTACAGCACCTTCACTG
TCTTGTGCGACGTCTTTCGTCATACCCTCTTCATACGACCCCGTCTGACTTGATACCGTCCTCCACACAGGATCG
ACAACTCTGACCCGAAGATTCTGACCTCCGAGCTTGCTATCATCGCGCAGCAGGAGAATTTCGATTGCTCCGAGA
CCATCTCGCAGTACCAGGTCACCATGCCTGCTGCGAGCGGTTATACCCTCATCTTCGCTAACCCCTTGAACAACA
CTGACGTGAGTGTCCCTCTGTGACATCTTCCCTTTTCACGCCGTCTATCGTCAGCGCAACTTACACGATTCTCGC
GCAGGTCTACGCCCAAACACAGCCCTTCGAGATCAAGGCCCTCGGTGCGACCTACCCGGCTGCCTCTGCTACACC
CACAGGAGGTTCGAGCGCGACCGTCAGCGGTAGCAGCAGTGCAGCGGCTTCTGGCGCGTCTGCATCGTCTACCGC
CGCGACCTCTAGCAAGAAGAATGCCGCGGGCCGTGTCGCCGCCCCAGTTGTAGCCCTCGCTGCCCTTGCGGCTGC
CGCCGGTATCGCCTTCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail