Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|147_1
Gene name
LocationNODE_147:9722..22569
Strand-
Gene length (bp)12847
Transcript length (bp)11739
Coding sequence length (bp)11739
Protein length (aa) 3913

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08354 DUF1729 Domain of unknown function (DUF1729) 4.2E-151 713 1067
PF00698 Acyl_transf_1 Acyl transferase domain 6.3E-71 1670 2043
PF18325 Fas_alpha_ACP Fatty acid synthase subunit alpha Acyl carrier domain 1.2E-71 2199 2360
PF18314 FAS_I_H Fatty acid synthase type I helical domain 6.2E-70 2388 2588
PF17951 FAS_meander Fatty acid synthase meander beta sheet domain 2.4E-48 1128 1274
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 1.1E-31 149 403
PF01575 MaoC_dehydratas MaoC like domain 2.4E-24 1544 1651
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 9.7E-23 3215 3423
PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta 4.0E-22 3 121
PF01648 ACPS 4'-phosphopantetheinyl transferase superfamily 1.8E-15 3793 3906
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.6E-12 3552 3641
PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase 2.0E-09 1288 1407

GO

GO Term Description Terminal node
GO:0004317 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity Yes
GO:0008897 holo-[acyl-carrier-protein] synthase activity Yes
GO:0016835 carbon-oxygen lyase activity No
GO:0016491 oxidoreductase activity No
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor No
GO:0016829 lyase activity No
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0004312 fatty acid synthase activity No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0019171 3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016746 acyltransferase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016836 hydro-lyase activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|147_1
MASTRPILIQSGPTRISIPVSTQCDEWTAAEVLRDEFSTTNTVDTQVDDTTQATIELFARFLGYSAQYLDADPHR
TTILLRGVKEFTSTYLSQQDVHTLAAAFDTDVRKTVLANYFRAFAALEAKNISEIPRAPSPALFTTQDASIYAIF
GGQGTNEVYFDELQNLYDTYTPYVAPFITSLTEEVLLPLAAEYGPTTYYAHGLDVLSWLTGARPRPPTAYLASIP
VSFPLIGLTQLTQYLVVCRTTGLTPAEMRSRLAGATGHSQGLVSAVVVAAATTVSTFVSESLKAMKWLFYCGYRG
QEAFPVLALEPSIVEDAIEGGEGAPSPMLSVTGLGLKELEGHISKTNAHLPPKSQLQVSLHNGPKTFVVTGPARA
LYGLVTHLRKVRAPSGLDQSKVPFSQRKPVFAVRFLVVGVPYHSEYLAGVTKKMFEEDLEGEELWTKEDLGIAVY
HTENGSDLRELSTSLTCALCDQIFTLPIHWAQATDFPETATHAIDFGPGGLSGIGPLTARNLDGRGVRVIVAGDK
AKGIVELYNTQNVKREEWWAKKFTPGLVKTSDGTIHIDTPFSRLLGKPPIMVAGMTPTTVQAGFVSAVLSAGYHV
ELAGGGHYNPAALRAKVAEIQANIPAGVGLTLNALYINPRQFGFQFPLWQEMRREGLPVEGFCVAAGIPSTEKAA
EIIDALRSAGIRHVSFKPGSVDGIRQVVNIAAANPDFPIILQWTGGRAGGHHSCEDFHQPILSTYSAIRQQSNIS
LVGGSGFGGADDVWPYLTGDWSVERYGMQPMPFDGFLFASRVMVAKEAHTSSSVKDLIVAASGVDDAQWEGTYAK
ETGGILTVKSELGEPIHKVATRAVKLWKEFDDTVFKLPKEKRVAWLTERRAEIIGKLNKDFSKPWFGWKKDGSVV
EDIADMTYEEVVLRMIRLMYVAHEERWVDTSLRNLTGDWLRRIEERFAGVNGGGAKSSILQSYTSLDKPQEFVAS
FFKAYPLATEQILASEDKAFFLAISQRPGQKPVPFIPILDASFEVWFKKDSLWAAEDIEAVFDQDPQRVCILQGP
VAVKHSMKKDEPIKEMLDNITSMLVQKLADRLYNGDLSRVPTVGYLSPSSSPISHNAFASLGVERAVKGNAITYV
VGANLPDATTWLETLAGPGQTWWRALLTSTTIVQGMSYVDNPMRRLFSPRRGQKVVVETDKESPVGVSVFGAARS
YGPHKASFKAVEVSFDKSQNVINVTLFEDRRDASVPLHLQFVYKPAMGFAPIHEIAEDRNKRIKDFYWRLWFGDD
QVLPEIDVRQTFTGPDVTISAAEVESFCTVVGNDGESFKTARADHVQAPMDFAIVTGWQAIMKAIFPSSIDGDIL
KLVHLSNGFRMVNGARSFQAGDVCNAEARIVSVVNNDAGKVVKVKGFVMRGGEPVVEVISSFLYRGRFADFENTF
ELIEEPDYFVELATDADIGVLQSKEWFEWDDETKPIHTGTTLIFRIQSDVTYRNKTCFKSVSVSGDIFVRDQLKR
LVKVGSVDFLQDDSRGNPVLAYLQRHGQPQGLPSPLANDGYTMTSTGSTIFNSPATNEPYSVVSGDFNPIHINPY
FSDYASLPGTITHGMWSSAATRRYVETVVAHGRPDRVIAYDVAFVGMILPRDELNVKLKHVAMRDGNIVVKVETF
NSQGEKVLEGTAEVAQPTTVYVFTGQGSQEPGMGMDLYNNSPAARSVWEAADAHLTAVYGFSIVEIVKANPKEKT
IHFGGIKGQQIRSRYMEMTYDTMDKDGNVKTLPLFGDINARTQRYTFSHPSGLLYATQFAQIALVVTERAAFEDM
RSKGLVQTGAAFAGHSLGEYSALASIADVLPISSLVDIVFYRGITMQRAVERDTQNRSNYAMCAVNPSRISKSFT
DAALREVVDDIAQHTGCLLEIVNFNVEGQQYVCAGELIALQTMTNVLNYLKVQKIDIQKLTEKFTIDQVKEMLRE
IIDSCYTRAKEQQAAEGYIKLERGFATIPLPGIDVPFHSRYLWAGVMPFRAYLSKKINPAQLNPDTLVGKYVPNL
IAKPFEISKDYVQLIYDRTLSVRLDKVLRKWDQDNWDAPEQRQKLAYITLVELLAYQFASPVRWIETQDILFTRY
HFERFIEIGPSPTLTGMATRTLKAKYEVQDDSVSRTRAILCHAKNTKEVYYQFEDAPEVAESDAQADNAAIQASV
VSTPIAVSAAPAPAASATPATSVDDVPLKAIEILSVIVAQKLKKKVDEVPLSKSLKDLSGGKSTLQNEILGDLQL
EFASAPEKGEELPLEELGSALSVGFSGSLGKYTSGLVGRLVGGKMPGGFNMSSIKAYLSKAWGLGPSRADGVLLL
GTTMEPAKRLASEADAKAWLDSIVALYAQRAGISLSAASTSGSGGGGGGGPTINSEEFLKFQAEQEWFASQQVEL
YMRYLKRDSRAGEHKYENEKANVDALQSRLDAIAREHGDTYIDGIQPVFDALKARHFDSSWNWVRQDALLMFYDI
IFGRLTTVDREITARCIAIMNRADPELVTYMQYYIDQCDPNRGDTYKLAKQFGQQLIDNCREVVGLPPLYRDVTF
PTAPHTEVTAKGDIVYSEVVRENVRKLEAYVEEMASGDTISAPTNMQKIQDDVLKLWTVVKSQPEISEEQKNRIK
ALYEGVVRSLRKRPESRARPGAPRTRRSSSQFLRPQISGIASVSADKVPLLHLKRRVGTTWEYSSNLTGVYLDIL
HEIATSGTTFKDKNALLTGVGKGSIGVEVLKGLLSGGAHVVITTSRYNRSTVEYYQSVFQRFGSKGSGLTVVPFN
QGSKQDVEALVDYIYSTLGLDLDYILPFAAVPENGREIDGLDDKSELAHRIMLVNLLRLLGAVKVKKASRHILTR
PTQVILPLSPNHGTFGRDGLYSESKIGLETLFNRWNSESWGEYLCMAGAVIGWTRGTGLMDATNIVAQEVEGNGV
RTFSAKEMAFNLLGLMHPLLFSITQVEPIWADLNGGMDRLPDLAEITTRIRGDLNKKSDLRRAIARDNAADFKVV
NGVEAERVLQTVNVTPRANFKFNFPSLESVESLSDVAALRGMLDLDQVVVVTGFAEVGPWGSSRTRWEMEARGEF
TIEGCIEMAWMMGYIKHFDGRLKDGSLYVGWVDSKTEEPVDDKDVKSRYEKDILGRAGIRLIEPELFRGYDPKKK
TFNQEIQLIHDLEAFEASQTEAEKFKYEHGDSCDIWAGEGGQWFVKLKKGARVMVPKAFKFNRLVAGQIPTGWHA
GRYGIPADIISQTDRTALWTLVAAADALNTSGITDPYELYQHMHPSEVGTSIGSGMGGMESLAKMFKDRRDEKDV
QNDILQETFINTTAGWVNLLLLSSCGPVKIPVGACATALQSVEIACDTLLSGKAKVMLAGGYDDFSEEGSYEFAN
MKATSNSETEFAMGREPTEMSRPATTTRGGFMEAQGTGVHVLMSAKTALEMGCPIRGIVAFTSTSTDKAGRSVPA
PGRGALTIAREIQSKHPLPILDIAYRSRQLAFRRRQIADWLENERHLLQEELEFRKSHNEPASGDYLASRVVDLE
KEAARQEKDALATYGMLQGVDPRVSPLRRALAVWGLTADDVGVLSIHGTGTGANENNETHVWNDVFANISRTPGN
AVPVMAQKSLCGHSKGGSAAWQLAGLLQSVGSGIVAGNRNADNVDSHFKDYTYLMFPSVSIHTDGIRAGLMSSFG
FGQVGGTCLVLHPRHVFGALEPSAYETYKAKNARRSRLTYKAMSEMMITNSLVRVKEGPPFTKDVEAAVMLNPLA
RTSYDSKTGSYVFTSKLATEPQVDTAHVKAVSQIISEKESTAGVGVDQELISSVPSWNPEFVKRNFTEAEIAYCR
GQPSSESSFAARWVGKEAVFKSLGVSSKGAAAPMKDIEILPDESGVPTVTLHGDAKSAAEAKGISKVHLSLSHSE
NVAIAFAQATSS*
Coding >RhoplFPRL280|147_1
ATGGCCAGTACACGCCCAATCTTGATCCAGTCGGGTCCCACTAGAATTTCCATTCCCGTCTCCACGCAATGCGAT
GAGTGGACAGCGGCGGAGGTCCTTCGCGATGAATTCTCCACTACCAACACCGTAGATACCCAAGTAGATGACACA
ACACAGGCGACCATAGAGCTTTTCGCCCGTTTTCTTGGGTACAGCGCACAATACCTAGACGCGGATCCGCATCGC
ACAACGATCTTACTCCGAGGTGTGAAGGAGTTTACATCCACCTACCTTTCGCAACAAGATGTGCACACGCTCGCG
GCCGCATTCGACACTGACGTGCGCAAGACCGTGCTCGCAAACTACTTCCGGGCGTTCGCCGCGCTGGAGGCAAAG
AACATTTCTGAAATTCCTCGCGCGCCATCACCAGCGCTATTCACGACGCAAGACGCGTCAATCTATGCAATTTTT
GGCGGCCAGGGGACGAACGAGGTCTATTTCGATGAGCTGCAAAACCTCTATGACACGTACACGCCGTACGTCGCG
CCATTCATCACTTCACTAACGGAGGAGGTGCTGCTGCCCCTGGCTGCGGAGTATGGACCTACGACATACTATGCG
CACGGTCTTGACGTGCTCTCATGGCTCACCGGCGCGAGGCCGCGCCCACCAACGGCATACCTGGCCTCCATCCCC
GTCTCATTCCCCCTGATCGGCTTGACGCAGCTGACGCAATACTTGGTCGTCTGCCGGACGACCGGCCTGACGCCT
GCAGAGATGCGGTCGCGGTTGGCTGGTGCGACTGGCCATTCACAGGGGCTAGTCTCAGCGGTGGTCGTGGCAGCA
GCGACTACAGTGTCGACGTTCGTCTCAGAGTCGCTGAAGGCGATGAAGTGGCTCTTCTATTGCGGATACCGAGGA
CAGGAGGCATTCCCCGTGCTCGCACTAGAGCCGAGCATTGTCGAAGACGCGATCGAGGGTGGAGAGGGTGCGCCG
AGCCCAATGTTGTCCGTGACTGGCTTGGGTTTGAAGGAGTTGGAGGGGCACATCTCGAAGACGAACGCACACCTA
CCGCCCAAGTCGCAGCTGCAGGTGTCTCTACACAATGGTCCGAAGACCTTCGTCGTGACTGGCCCGGCACGCGCG
CTTTATGGCCTAGTAACGCACCTGCGCAAGGTTCGCGCGCCCAGTGGCCTCGATCAGAGCAAGGTTCCCTTCTCG
CAGAGGAAGCCTGTATTCGCGGTGCGCTTCCTGGTGGTCGGCGTCCCCTACCACAGCGAGTATCTCGCGGGAGTG
ACGAAGAAGATGTTCGAAGAGGATTTGGAGGGCGAGGAGCTTTGGACGAAGGAGGATCTCGGAATTGCTGTCTAT
CACACAGAGAACGGATCGGATTTGCGGGAGCTATCGACATCATTGACGTGCGCCTTGTGCGACCAAATCTTCACG
CTCCCCATCCATTGGGCACAGGCAACTGACTTCCCTGAGACGGCTACGCACGCGATTGACTTCGGTCCTGGCGGG
CTCAGCGGCATCGGTCCTCTCACAGCGCGGAATCTGGACGGCCGTGGCGTACGCGTCATCGTCGCGGGGGACAAG
GCCAAGGGCATCGTCGAGTTGTATAACACGCAGAACGTGAAGCGCGAGGAGTGGTGGGCGAAGAAGTTCACGCCC
GGTCTTGTGAAGACTAGCGACGGCACCATCCACATCGATACCCCATTCTCTCGCCTGCTTGGCAAGCCCCCAATC
ATGGTTGCTGGTATGACGCCGACTACTGTCCAAGCTGGTTTCGTTAGCGCGGTTCTCTCTGCTGGTTATCACGTC
GAACTTGCCGGTGGTGGGCACTACAATCCCGCAGCCCTGCGCGCGAAGGTCGCCGAAATACAGGCGAATATTCCT
GCTGGCGTCGGTCTGACGCTCAATGCTCTCTACATCAACCCTCGTCAGTTCGGCTTCCAATTCCCACTGTGGCAG
GAGATGCGTCGGGAAGGTCTTCCCGTTGAGGGGTTCTGTGTCGCTGCGGGTATCCCAAGCACAGAGAAGGCGGCC
GAAATCATCGACGCTCTCAGGAGCGCAGGCATCCGTCATGTTTCCTTCAAGCCCGGCTCTGTCGACGGCATCCGC
CAGGTCGTGAATATCGCTGCGGCCAACCCCGACTTCCCCATTATCCTGCAGTGGACAGGCGGCCGCGCAGGCGGT
CACCATTCGTGTGAGGACTTCCACCAGCCGATTTTGTCGACATATAGCGCGATCCGCCAGCAGAGCAACATCTCG
CTGGTCGGTGGTTCTGGCTTCGGTGGTGCCGACGACGTCTGGCCGTACCTCACGGGTGATTGGTCAGTGGAGCGC
TATGGCATGCAGCCAATGCCCTTCGACGGCTTCCTGTTCGCGAGTCGGGTCATGGTTGCGAAGGAGGCGCACACG
AGCTCCTCTGTGAAGGACCTCATCGTCGCTGCGAGTGGTGTCGATGACGCGCAGTGGGAAGGCACCTACGCGAAG
GAGACCGGCGGCATCCTGACCGTCAAGTCGGAGCTTGGTGAACCGATCCACAAGGTTGCAACGCGTGCCGTCAAG
CTCTGGAAGGAGTTCGACGACACGGTGTTCAAGCTGCCAAAGGAGAAGCGCGTTGCGTGGCTGACAGAGCGTCGG
GCGGAAATTATCGGGAAGTTGAACAAGGACTTCTCCAAGCCGTGGTTCGGTTGGAAGAAAGACGGGTCGGTGGTT
GAGGACATCGCCGATATGACATACGAGGAGGTTGTCTTGCGCATGATTCGTTTGATGTATGTCGCGCATGAGGAG
CGCTGGGTCGACACCTCGCTGAGGAACCTGACTGGCGACTGGCTTCGCCGCATTGAGGAGCGGTTTGCGGGTGTG
AACGGTGGCGGGGCGAAGTCATCTATCCTCCAATCATACACATCCCTCGACAAGCCCCAGGAATTCGTCGCATCG
TTCTTTAAGGCTTACCCGCTCGCGACCGAGCAGATTCTTGCCTCGGAGGACAAGGCCTTCTTCCTCGCAATCTCT
CAGCGCCCTGGTCAGAAGCCGGTTCCGTTCATCCCTATCCTTGATGCCAGCTTCGAGGTGTGGTTCAAGAAGGAC
TCCCTGTGGGCAGCTGAGGACATCGAGGCTGTCTTCGACCAAGACCCGCAGCGTGTTTGCATCCTTCAAGGCCCG
GTCGCTGTCAAGCACTCCATGAAGAAGGATGAGCCCATCAAGGAGATGCTGGACAACATCACGTCGATGCTCGTC
CAGAAGCTGGCGGATCGTCTCTACAATGGTGATCTGAGCCGCGTTCCTACTGTCGGCTATCTCAGTCCTTCCTCG
TCGCCTATCTCTCACAATGCATTCGCTTCTCTTGGCGTTGAGCGTGCTGTCAAGGGCAATGCCATCACATATGTT
GTCGGCGCGAACCTTCCCGACGCTACGACTTGGCTAGAGACTCTGGCAGGACCAGGACAAACTTGGTGGAGGGCA
CTCCTTACATCGACTACCATCGTGCAAGGGATGTCCTACGTCGACAACCCAATGCGACGACTCTTCTCGCCTCGT
CGTGGGCAAAAGGTCGTTGTTGAGACTGATAAGGAGTCGCCTGTGGGAGTGTCTGTCTTCGGCGCTGCACGGTCT
TATGGTCCGCACAAGGCATCGTTCAAGGCAGTTGAAGTTAGCTTCGACAAATCGCAAAATGTCATTAACGTCACG
CTATTCGAAGATCGTCGCGATGCCTCCGTTCCTCTTCATCTACAATTTGTCTACAAGCCTGCGATGGGCTTCGCT
CCCATCCACGAAATCGCTGAAGATCGCAACAAGCGCATCAAGGACTTCTATTGGCGCTTGTGGTTCGGCGATGAT
CAGGTCCTCCCTGAGATCGACGTTCGGCAGACGTTCACCGGTCCTGACGTCACCATTAGTGCGGCCGAAGTTGAG
AGTTTCTGCACAGTTGTCGGCAACGACGGCGAGTCTTTCAAGACAGCTCGGGCAGACCATGTCCAAGCACCAATG
GACTTTGCCATTGTTACGGGCTGGCAGGCGATCATGAAAGCGATCTTTCCCTCGTCGATCGATGGTGACATACTG
AAGCTTGTTCATCTGTCTAACGGGTTCCGTATGGTCAACGGCGCGAGATCGTTCCAAGCGGGCGATGTTTGCAAC
GCGGAGGCTCGTATTGTCTCAGTTGTGAACAACGATGCAGGGAAGGTCGTCAAAGTCAAGGGTTTCGTGATGCGC
GGTGGCGAGCCTGTCGTTGAAGTTATATCATCGTTCCTCTACCGTGGCCGCTTCGCCGACTTCGAGAATACCTTC
GAATTGATCGAGGAGCCGGACTATTTCGTTGAGCTTGCAACAGATGCGGACATCGGTGTCCTCCAATCCAAGGAG
TGGTTTGAATGGGATGACGAGACGAAGCCTATCCATACTGGAACTACTCTCATCTTCCGCATCCAGTCCGACGTC
ACCTATCGCAACAAGACGTGTTTCAAATCTGTCTCGGTCTCCGGTGATATCTTTGTTCGTGATCAGCTCAAGCGC
CTCGTTAAGGTTGGGAGCGTCGATTTCCTCCAAGACGACAGCCGCGGCAATCCCGTGCTCGCCTACTTGCAGCGC
CATGGTCAGCCTCAAGGACTTCCAAGCCCTCTTGCGAACGATGGCTACACGATGACGTCTACGGGTTCAACTATC
TTCAATTCCCCTGCTACCAATGAGCCGTATTCCGTCGTTTCGGGTGACTTCAACCCTATCCACATCAACCCGTAC
TTCTCGGATTATGCGTCGCTTCCTGGGACCATCACGCACGGCATGTGGTCAAGTGCTGCCACTAGACGCTATGTC
GAGACAGTCGTCGCTCATGGCCGTCCTGACCGTGTTATTGCTTATGATGTTGCGTTCGTTGGTATGATTCTCCCT
CGGGATGAACTCAACGTCAAGCTCAAGCACGTTGCCATGCGTGACGGCAACATTGTCGTCAAGGTCGAGACATTT
AATTCGCAAGGAGAGAAGGTCCTGGAAGGCACCGCGGAGGTTGCGCAGCCTACCACTGTCTATGTATTCACCGGC
CAAGGTTCGCAGGAGCCTGGTATGGGCATGGATCTCTACAACAATTCCCCTGCTGCTCGCTCTGTGTGGGAGGCT
GCCGACGCACACCTTACTGCTGTATACGGATTTTCGATCGTCGAGATTGTCAAGGCCAACCCGAAAGAGAAGACG
ATCCATTTCGGTGGGATAAAGGGGCAGCAAATCCGTTCACGCTATATGGAGATGACTTACGACACCATGGACAAG
GACGGTAACGTGAAGACGCTCCCTCTCTTCGGTGACATCAATGCCCGTACGCAGAGATATACCTTTAGCCATCCA
TCCGGCCTGTTGTACGCGACGCAGTTTGCGCAGATCGCACTTGTCGTGACTGAGCGTGCGGCGTTCGAGGACATG
CGCTCGAAAGGTTTGGTCCAAACTGGTGCTGCTTTCGCCGGTCACTCTTTGGGCGAATACTCAGCTTTGGCTTCG
ATCGCGGATGTTCTGCCAATCTCGTCACTCGTCGACATCGTCTTCTACCGTGGTATCACCATGCAGCGCGCTGTG
GAACGCGACACCCAGAACCGATCTAACTATGCAATGTGTGCCGTGAATCCTAGTCGCATCTCGAAGTCGTTCACA
GATGCTGCGCTCCGTGAAGTTGTGGATGATATCGCTCAACACACAGGTTGCCTTCTGGAAATTGTGAACTTCAAC
GTAGAGGGTCAACAATACGTCTGTGCCGGTGAACTGATCGCGCTGCAGACGATGACCAATGTCTTGAATTACCTG
AAGGTCCAGAAGATCGACATCCAGAAGCTAACCGAGAAGTTCACGATCGATCAAGTCAAGGAAATGCTCCGCGAA
ATCATTGACTCTTGCTACACACGTGCGAAGGAACAGCAGGCGGCTGAAGGCTACATCAAGCTCGAACGTGGATTC
GCAACGATTCCCTTACCCGGAATTGACGTACCCTTCCACTCACGTTACTTATGGGCTGGTGTCATGCCATTCCGA
GCTTACCTCTCGAAGAAGATTAACCCCGCGCAGCTCAATCCCGATACCTTGGTTGGCAAATATGTCCCGAATCTC
ATTGCCAAGCCCTTTGAGATCTCGAAGGACTACGTGCAGCTCATCTATGATCGCACCCTGTCTGTACGATTGGAC
AAGGTCCTCCGGAAGTGGGATCAAGACAACTGGGATGCACCGGAGCAGCGACAGAAGCTCGCCTATATCACGCTG
GTCGAGCTGCTCGCGTACCAGTTTGCGTCACCTGTACGATGGATCGAGACGCAGGATATCCTTTTCACGCGTTAC
CACTTCGAACGCTTCATCGAGATTGGACCGTCGCCGACGCTTACCGGTATGGCCACTCGCACTCTGAAGGCGAAG
TACGAGGTACAGGATGATTCAGTCAGCCGGACGCGTGCAATCTTGTGTCATGCGAAGAACACTAAGGAGGTCTAC
TACCAATTCGAGGATGCACCAGAAGTTGCGGAATCTGATGCACAGGCTGACAACGCGGCAATACAGGCTTCCGTT
GTTAGCACACCTATCGCTGTGTCTGCTGCCCCTGCGCCCGCTGCCAGTGCCACCCCGGCCACTAGCGTAGATGAT
GTTCCCCTGAAGGCCATCGAAATTCTCAGCGTCATCGTTGCGCAGAAGTTGAAGAAGAAAGTGGACGAAGTCCCA
TTGTCGAAATCGCTGAAGGACCTATCCGGTGGCAAGTCTACCCTTCAGAACGAGATCCTTGGTGACCTCCAACTC
GAGTTTGCGTCTGCTCCGGAGAAGGGTGAGGAGCTCCCTCTTGAGGAGCTAGGCTCTGCCTTGAGTGTGGGCTTC
TCTGGGAGTTTGGGCAAGTACACCTCTGGTCTCGTCGGACGTCTCGTTGGCGGCAAGATGCCTGGTGGATTCAAC
ATGTCTTCAATCAAGGCGTATCTTTCTAAGGCCTGGGGTCTCGGTCCTTCTCGTGCTGATGGCGTCCTCCTCCTT
GGTACCACTATGGAACCTGCTAAACGTCTCGCTTCAGAGGCGGACGCGAAGGCGTGGCTGGACTCGATCGTCGCG
TTGTATGCCCAGCGTGCCGGGATCTCCCTTTCTGCAGCCAGTACCTCTGGTAGTGGCGGAGGCGGTGGCGGCGGC
CCCACGATCAACAGTGAAGAATTCCTGAAATTCCAGGCGGAGCAGGAATGGTTCGCCTCGCAGCAGGTCGAATTA
TACATGCGATATCTCAAGCGCGACTCTCGAGCTGGCGAGCACAAGTATGAAAATGAGAAGGCCAATGTCGATGCG
CTTCAGTCAAGACTGGACGCCATCGCGAGAGAACACGGCGACACCTACATTGATGGAATTCAACCCGTCTTTGAC
GCTCTGAAGGCCCGCCACTTCGATTCTTCATGGAACTGGGTTCGTCAGGATGCACTCCTCATGTTCTACGACATC
ATCTTCGGCCGTCTTACTACTGTCGACCGGGAAATTACCGCGCGTTGCATCGCTATCATGAACCGCGCCGACCCA
GAGCTAGTGACGTACATGCAATACTATATTGACCAGTGTGATCCCAACCGTGGCGATACATACAAGCTGGCGAAA
CAGTTCGGCCAACAGCTCATCGACAACTGCCGTGAAGTGGTCGGTCTACCTCCTCTGTACAGGGATGTTACGTTC
CCAACGGCGCCGCACACCGAGGTGACTGCGAAGGGAGACATTGTCTACTCCGAGGTGGTTCGCGAGAACGTGCGC
AAGTTGGAGGCATATGTAGAGGAGATGGCCAGTGGTGACACTATTTCGGCTCCCACCAACATGCAGAAGATCCAA
GACGATGTTCTCAAGCTGTGGACCGTCGTCAAGTCTCAGCCGGAGATCAGCGAGGAGCAGAAGAACCGTATCAAG
GCTCTGTACGAAGGCGTCGTTCGATCTCTCCGCAAGCGTCCGGAGTCGCGCGCTCGTCCTGGAGCACCAAGGACT
CGCCGTTCGTCTTCGCAATTCCTTCGGCCCCAGATCTCTGGCATCGCATCCGTGTCTGCTGACAAGGTTCCACTC
TTGCACCTAAAGCGCAGAGTTGGTACAACTTGGGAGTACAGCAGCAACCTCACTGGTGTCTATCTCGACATCTTG
CATGAGATTGCCACGTCTGGCACTACGTTCAAGGACAAGAACGCTCTACTCACCGGTGTTGGTAAGGGATCAATC
GGAGTCGAAGTGCTCAAGGGACTTCTCTCTGGCGGAGCGCACGTTGTCATAACCACTTCTCGCTACAACCGGTCG
ACCGTCGAGTACTACCAGAGCGTCTTCCAGCGCTTTGGTAGCAAGGGATCTGGACTGACTGTTGTCCCCTTCAAC
CAAGGCTCCAAGCAAGACGTCGAAGCCCTCGTCGACTACATCTACTCTACCCTGGGCCTTGACCTTGACTATATT
CTCCCCTTCGCTGCCGTCCCTGAGAACGGGCGTGAGATTGATGGCTTGGATGACAAGTCTGAGCTCGCACACCGA
ATCATGCTGGTCAACCTCCTTCGTTTACTAGGCGCAGTCAAGGTGAAGAAGGCGTCTCGACATATCTTGACTCGA
CCCACTCAGGTGATCCTGCCCCTATCGCCCAACCACGGAACATTTGGACGGGATGGCCTCTACTCCGAATCCAAG
ATCGGTCTGGAGACGCTGTTTAACAGGTGGAATTCTGAGAGCTGGGGGGAGTACCTCTGTATGGCTGGCGCCGTT
ATAGGGTGGACTCGTGGCACGGGCTTAATGGACGCAACCAACATCGTAGCGCAGGAAGTCGAAGGCAACGGCGTG
CGCACCTTCTCCGCGAAGGAGATGGCCTTCAACCTCCTCGGCTTGATGCACCCCCTCTTGTTCAGCATTACCCAA
GTCGAACCGATCTGGGCCGATCTGAACGGTGGCATGGATCGTCTCCCTGATCTCGCTGAGATTACGACCCGTATA
CGTGGTGACCTCAACAAAAAGAGTGATCTTCGTCGTGCAATTGCTCGAGACAACGCAGCGGACTTCAAGGTCGTC
AACGGGGTCGAGGCCGAGCGCGTTCTCCAGACAGTGAACGTAACACCTCGCGCTAATTTCAAGTTCAATTTCCCT
TCACTAGAGTCTGTGGAGTCTTTATCCGATGTTGCTGCCCTCCGAGGAATGCTGGATCTTGACCAGGTTGTCGTC
GTAACAGGCTTCGCGGAAGTGGGGCCTTGGGGTAGTTCGCGTACCAGGTGGGAAATGGAAGCTCGCGGTGAATTC
ACTATCGAAGGCTGCATCGAGATGGCGTGGATGATGGGCTACATCAAGCACTTCGACGGGCGATTGAAGGACGGC
TCTCTGTACGTGGGTTGGGTTGACTCCAAGACTGAAGAACCTGTGGACGACAAGGATGTCAAGAGTCGCTACGAG
AAAGACATTCTCGGCCGTGCTGGGATTCGTCTCATCGAACCGGAGCTCTTCCGCGGATATGATCCCAAGAAGAAG
ACATTCAATCAAGAGATACAGTTGATTCATGATCTTGAAGCGTTCGAGGCGAGTCAGACTGAAGCTGAGAAGTTC
AAATACGAACACGGCGACAGCTGCGATATATGGGCTGGCGAGGGAGGACAGTGGTTCGTCAAGCTCAAGAAGGGT
GCGCGCGTCATGGTGCCGAAAGCCTTCAAGTTCAACCGTCTTGTCGCTGGTCAGATTCCTACCGGATGGCACGCT
GGTCGTTACGGTATCCCTGCGGACATCATCTCTCAAACCGACCGTACCGCTCTATGGACTCTGGTTGCAGCAGCA
GATGCGCTCAACACGTCCGGTATCACCGATCCGTACGAGTTGTACCAACACATGCATCCATCCGAGGTTGGCACT
AGCATTGGTAGCGGTATGGGCGGTATGGAAAGTCTGGCGAAGATGTTCAAGGACCGCCGAGACGAAAAGGACGTA
CAAAATGACATCCTGCAGGAGACGTTCATCAACACGACCGCAGGATGGGTCAATCTCCTTCTGCTTTCATCTTGT
GGACCAGTGAAGATTCCTGTCGGTGCCTGTGCGACTGCTCTGCAATCGGTAGAGATCGCTTGTGATACACTCTTA
TCCGGTAAAGCCAAAGTGATGCTGGCGGGAGGATACGATGACTTCAGCGAGGAAGGCTCCTACGAGTTCGCGAAC
ATGAAGGCCACTAGTAACTCGGAGACTGAGTTCGCTATGGGTCGAGAGCCAACAGAGATGTCGAGGCCTGCCACC
ACGACTCGTGGAGGATTCATGGAAGCACAAGGCACGGGTGTACACGTCCTCATGAGTGCGAAGACAGCGTTGGAA
ATGGGTTGCCCAATTCGTGGCATTGTCGCATTCACATCGACATCCACCGATAAGGCAGGAAGATCAGTCCCTGCT
CCAGGACGCGGTGCGCTCACCATCGCCAGAGAGATTCAGTCGAAACACCCTCTTCCTATTCTTGATATTGCATAC
CGTTCACGACAGCTCGCGTTCCGTCGTCGCCAGATTGCTGATTGGTTGGAGAATGAGCGACACCTACTGCAAGAG
GAGCTCGAGTTCCGAAAGAGTCACAACGAGCCCGCCAGCGGAGACTACCTCGCCAGTCGCGTAGTTGACCTAGAG
AAGGAGGCTGCCCGTCAGGAGAAGGATGCTTTGGCAACGTACGGCATGCTTCAAGGTGTTGACCCTCGAGTGTCC
CCTCTCCGTCGCGCACTAGCCGTCTGGGGGCTGACTGCAGACGACGTTGGCGTGCTGTCCATCCATGGTACCGGT
ACTGGTGCAAACGAGAACAATGAGACACACGTCTGGAATGATGTCTTCGCCAATATCTCTCGCACCCCGGGCAAC
GCTGTACCTGTCATGGCTCAGAAGAGTCTCTGCGGCCACTCCAAAGGTGGGTCAGCTGCATGGCAACTGGCCGGT
CTGCTTCAGAGCGTGGGAAGTGGTATCGTCGCGGGCAACAGAAATGCCGACAACGTGGACTCGCACTTCAAGGAC
TACACGTACTTGATGTTCCCGTCGGTGTCGATTCATACCGATGGCATCCGTGCAGGCCTTATGTCGTCATTCGGG
TTCGGTCAAGTCGGTGGAACTTGTCTCGTCTTGCATCCTCGCCACGTCTTCGGTGCCCTCGAGCCGTCTGCATAT
GAAACCTACAAGGCCAAGAATGCTCGCCGCTCCCGCCTCACATATAAGGCCATGAGTGAGATGATGATCACCAAC
TCATTGGTTCGGGTGAAGGAGGGCCCGCCTTTCACGAAGGACGTCGAGGCAGCCGTTATGCTTAACCCTCTCGCA
AGGACTTCCTACGATTCGAAGACGGGCAGCTATGTCTTCACGTCCAAGCTGGCCACGGAGCCTCAGGTCGATACG
GCTCACGTCAAGGCGGTCTCACAGATCATCTCGGAGAAGGAATCCACCGCAGGAGTCGGTGTCGACCAAGAACTG
ATCTCGTCGGTGCCGTCGTGGAATCCCGAGTTCGTTAAGCGCAACTTCACTGAGGCCGAAATTGCCTACTGCCGA
GGACAGCCGTCTTCTGAGTCTTCCTTCGCCGCACGGTGGGTCGGCAAGGAAGCCGTCTTCAAGTCGCTTGGTGTC
TCGTCGAAGGGTGCCGCGGCGCCGATGAAGGACATCGAGATCCTGCCCGACGAATCCGGCGTTCCTACGGTCACG
CTGCACGGCGACGCTAAGTCTGCGGCCGAGGCTAAGGGTATCTCGAAAGTCCATCTATCGCTCAGCCACTCAGAG
AATGTCGCCATCGCGTTTGCGCAAGCCACGTCTTCATGA
Transcript >RhoplFPRL280|147_1
ATGGCCAGTACACGCCCAATCTTGATCCAGTCGGGTCCCACTAGAATTTCCATTCCCGTCTCCACGCAATGCGAT
GAGTGGACAGCGGCGGAGGTCCTTCGCGATGAATTCTCCACTACCAACACCGTAGATACCCAAGTAGATGACACA
ACACAGGCGACCATAGAGCTTTTCGCCCGTTTTCTTGGGTACAGCGCACAATACCTAGACGCGGATCCGCATCGC
ACAACGATCTTACTCCGAGGTGTGAAGGAGTTTACATCCACCTACCTTTCGCAACAAGATGTGCACACGCTCGCG
GCCGCATTCGACACTGACGTGCGCAAGACCGTGCTCGCAAACTACTTCCGGGCGTTCGCCGCGCTGGAGGCAAAG
AACATTTCTGAAATTCCTCGCGCGCCATCACCAGCGCTATTCACGACGCAAGACGCGTCAATCTATGCAATTTTT
GGCGGCCAGGGGACGAACGAGGTCTATTTCGATGAGCTGCAAAACCTCTATGACACGTACACGCCGTACGTCGCG
CCATTCATCACTTCACTAACGGAGGAGGTGCTGCTGCCCCTGGCTGCGGAGTATGGACCTACGACATACTATGCG
CACGGTCTTGACGTGCTCTCATGGCTCACCGGCGCGAGGCCGCGCCCACCAACGGCATACCTGGCCTCCATCCCC
GTCTCATTCCCCCTGATCGGCTTGACGCAGCTGACGCAATACTTGGTCGTCTGCCGGACGACCGGCCTGACGCCT
GCAGAGATGCGGTCGCGGTTGGCTGGTGCGACTGGCCATTCACAGGGGCTAGTCTCAGCGGTGGTCGTGGCAGCA
GCGACTACAGTGTCGACGTTCGTCTCAGAGTCGCTGAAGGCGATGAAGTGGCTCTTCTATTGCGGATACCGAGGA
CAGGAGGCATTCCCCGTGCTCGCACTAGAGCCGAGCATTGTCGAAGACGCGATCGAGGGTGGAGAGGGTGCGCCG
AGCCCAATGTTGTCCGTGACTGGCTTGGGTTTGAAGGAGTTGGAGGGGCACATCTCGAAGACGAACGCACACCTA
CCGCCCAAGTCGCAGCTGCAGGTGTCTCTACACAATGGTCCGAAGACCTTCGTCGTGACTGGCCCGGCACGCGCG
CTTTATGGCCTAGTAACGCACCTGCGCAAGGTTCGCGCGCCCAGTGGCCTCGATCAGAGCAAGGTTCCCTTCTCG
CAGAGGAAGCCTGTATTCGCGGTGCGCTTCCTGGTGGTCGGCGTCCCCTACCACAGCGAGTATCTCGCGGGAGTG
ACGAAGAAGATGTTCGAAGAGGATTTGGAGGGCGAGGAGCTTTGGACGAAGGAGGATCTCGGAATTGCTGTCTAT
CACACAGAGAACGGATCGGATTTGCGGGAGCTATCGACATCATTGACGTGCGCCTTGTGCGACCAAATCTTCACG
CTCCCCATCCATTGGGCACAGGCAACTGACTTCCCTGAGACGGCTACGCACGCGATTGACTTCGGTCCTGGCGGG
CTCAGCGGCATCGGTCCTCTCACAGCGCGGAATCTGGACGGCCGTGGCGTACGCGTCATCGTCGCGGGGGACAAG
GCCAAGGGCATCGTCGAGTTGTATAACACGCAGAACGTGAAGCGCGAGGAGTGGTGGGCGAAGAAGTTCACGCCC
GGTCTTGTGAAGACTAGCGACGGCACCATCCACATCGATACCCCATTCTCTCGCCTGCTTGGCAAGCCCCCAATC
ATGGTTGCTGGTATGACGCCGACTACTGTCCAAGCTGGTTTCGTTAGCGCGGTTCTCTCTGCTGGTTATCACGTC
GAACTTGCCGGTGGTGGGCACTACAATCCCGCAGCCCTGCGCGCGAAGGTCGCCGAAATACAGGCGAATATTCCT
GCTGGCGTCGGTCTGACGCTCAATGCTCTCTACATCAACCCTCGTCAGTTCGGCTTCCAATTCCCACTGTGGCAG
GAGATGCGTCGGGAAGGTCTTCCCGTTGAGGGGTTCTGTGTCGCTGCGGGTATCCCAAGCACAGAGAAGGCGGCC
GAAATCATCGACGCTCTCAGGAGCGCAGGCATCCGTCATGTTTCCTTCAAGCCCGGCTCTGTCGACGGCATCCGC
CAGGTCGTGAATATCGCTGCGGCCAACCCCGACTTCCCCATTATCCTGCAGTGGACAGGCGGCCGCGCAGGCGGT
CACCATTCGTGTGAGGACTTCCACCAGCCGATTTTGTCGACATATAGCGCGATCCGCCAGCAGAGCAACATCTCG
CTGGTCGGTGGTTCTGGCTTCGGTGGTGCCGACGACGTCTGGCCGTACCTCACGGGTGATTGGTCAGTGGAGCGC
TATGGCATGCAGCCAATGCCCTTCGACGGCTTCCTGTTCGCGAGTCGGGTCATGGTTGCGAAGGAGGCGCACACG
AGCTCCTCTGTGAAGGACCTCATCGTCGCTGCGAGTGGTGTCGATGACGCGCAGTGGGAAGGCACCTACGCGAAG
GAGACCGGCGGCATCCTGACCGTCAAGTCGGAGCTTGGTGAACCGATCCACAAGGTTGCAACGCGTGCCGTCAAG
CTCTGGAAGGAGTTCGACGACACGGTGTTCAAGCTGCCAAAGGAGAAGCGCGTTGCGTGGCTGACAGAGCGTCGG
GCGGAAATTATCGGGAAGTTGAACAAGGACTTCTCCAAGCCGTGGTTCGGTTGGAAGAAAGACGGGTCGGTGGTT
GAGGACATCGCCGATATGACATACGAGGAGGTTGTCTTGCGCATGATTCGTTTGATGTATGTCGCGCATGAGGAG
CGCTGGGTCGACACCTCGCTGAGGAACCTGACTGGCGACTGGCTTCGCCGCATTGAGGAGCGGTTTGCGGGTGTG
AACGGTGGCGGGGCGAAGTCATCTATCCTCCAATCATACACATCCCTCGACAAGCCCCAGGAATTCGTCGCATCG
TTCTTTAAGGCTTACCCGCTCGCGACCGAGCAGATTCTTGCCTCGGAGGACAAGGCCTTCTTCCTCGCAATCTCT
CAGCGCCCTGGTCAGAAGCCGGTTCCGTTCATCCCTATCCTTGATGCCAGCTTCGAGGTGTGGTTCAAGAAGGAC
TCCCTGTGGGCAGCTGAGGACATCGAGGCTGTCTTCGACCAAGACCCGCAGCGTGTTTGCATCCTTCAAGGCCCG
GTCGCTGTCAAGCACTCCATGAAGAAGGATGAGCCCATCAAGGAGATGCTGGACAACATCACGTCGATGCTCGTC
CAGAAGCTGGCGGATCGTCTCTACAATGGTGATCTGAGCCGCGTTCCTACTGTCGGCTATCTCAGTCCTTCCTCG
TCGCCTATCTCTCACAATGCATTCGCTTCTCTTGGCGTTGAGCGTGCTGTCAAGGGCAATGCCATCACATATGTT
GTCGGCGCGAACCTTCCCGACGCTACGACTTGGCTAGAGACTCTGGCAGGACCAGGACAAACTTGGTGGAGGGCA
CTCCTTACATCGACTACCATCGTGCAAGGGATGTCCTACGTCGACAACCCAATGCGACGACTCTTCTCGCCTCGT
CGTGGGCAAAAGGTCGTTGTTGAGACTGATAAGGAGTCGCCTGTGGGAGTGTCTGTCTTCGGCGCTGCACGGTCT
TATGGTCCGCACAAGGCATCGTTCAAGGCAGTTGAAGTTAGCTTCGACAAATCGCAAAATGTCATTAACGTCACG
CTATTCGAAGATCGTCGCGATGCCTCCGTTCCTCTTCATCTACAATTTGTCTACAAGCCTGCGATGGGCTTCGCT
CCCATCCACGAAATCGCTGAAGATCGCAACAAGCGCATCAAGGACTTCTATTGGCGCTTGTGGTTCGGCGATGAT
CAGGTCCTCCCTGAGATCGACGTTCGGCAGACGTTCACCGGTCCTGACGTCACCATTAGTGCGGCCGAAGTTGAG
AGTTTCTGCACAGTTGTCGGCAACGACGGCGAGTCTTTCAAGACAGCTCGGGCAGACCATGTCCAAGCACCAATG
GACTTTGCCATTGTTACGGGCTGGCAGGCGATCATGAAAGCGATCTTTCCCTCGTCGATCGATGGTGACATACTG
AAGCTTGTTCATCTGTCTAACGGGTTCCGTATGGTCAACGGCGCGAGATCGTTCCAAGCGGGCGATGTTTGCAAC
GCGGAGGCTCGTATTGTCTCAGTTGTGAACAACGATGCAGGGAAGGTCGTCAAAGTCAAGGGTTTCGTGATGCGC
GGTGGCGAGCCTGTCGTTGAAGTTATATCATCGTTCCTCTACCGTGGCCGCTTCGCCGACTTCGAGAATACCTTC
GAATTGATCGAGGAGCCGGACTATTTCGTTGAGCTTGCAACAGATGCGGACATCGGTGTCCTCCAATCCAAGGAG
TGGTTTGAATGGGATGACGAGACGAAGCCTATCCATACTGGAACTACTCTCATCTTCCGCATCCAGTCCGACGTC
ACCTATCGCAACAAGACGTGTTTCAAATCTGTCTCGGTCTCCGGTGATATCTTTGTTCGTGATCAGCTCAAGCGC
CTCGTTAAGGTTGGGAGCGTCGATTTCCTCCAAGACGACAGCCGCGGCAATCCCGTGCTCGCCTACTTGCAGCGC
CATGGTCAGCCTCAAGGACTTCCAAGCCCTCTTGCGAACGATGGCTACACGATGACGTCTACGGGTTCAACTATC
TTCAATTCCCCTGCTACCAATGAGCCGTATTCCGTCGTTTCGGGTGACTTCAACCCTATCCACATCAACCCGTAC
TTCTCGGATTATGCGTCGCTTCCTGGGACCATCACGCACGGCATGTGGTCAAGTGCTGCCACTAGACGCTATGTC
GAGACAGTCGTCGCTCATGGCCGTCCTGACCGTGTTATTGCTTATGATGTTGCGTTCGTTGGTATGATTCTCCCT
CGGGATGAACTCAACGTCAAGCTCAAGCACGTTGCCATGCGTGACGGCAACATTGTCGTCAAGGTCGAGACATTT
AATTCGCAAGGAGAGAAGGTCCTGGAAGGCACCGCGGAGGTTGCGCAGCCTACCACTGTCTATGTATTCACCGGC
CAAGGTTCGCAGGAGCCTGGTATGGGCATGGATCTCTACAACAATTCCCCTGCTGCTCGCTCTGTGTGGGAGGCT
GCCGACGCACACCTTACTGCTGTATACGGATTTTCGATCGTCGAGATTGTCAAGGCCAACCCGAAAGAGAAGACG
ATCCATTTCGGTGGGATAAAGGGGCAGCAAATCCGTTCACGCTATATGGAGATGACTTACGACACCATGGACAAG
GACGGTAACGTGAAGACGCTCCCTCTCTTCGGTGACATCAATGCCCGTACGCAGAGATATACCTTTAGCCATCCA
TCCGGCCTGTTGTACGCGACGCAGTTTGCGCAGATCGCACTTGTCGTGACTGAGCGTGCGGCGTTCGAGGACATG
CGCTCGAAAGGTTTGGTCCAAACTGGTGCTGCTTTCGCCGGTCACTCTTTGGGCGAATACTCAGCTTTGGCTTCG
ATCGCGGATGTTCTGCCAATCTCGTCACTCGTCGACATCGTCTTCTACCGTGGTATCACCATGCAGCGCGCTGTG
GAACGCGACACCCAGAACCGATCTAACTATGCAATGTGTGCCGTGAATCCTAGTCGCATCTCGAAGTCGTTCACA
GATGCTGCGCTCCGTGAAGTTGTGGATGATATCGCTCAACACACAGGTTGCCTTCTGGAAATTGTGAACTTCAAC
GTAGAGGGTCAACAATACGTCTGTGCCGGTGAACTGATCGCGCTGCAGACGATGACCAATGTCTTGAATTACCTG
AAGGTCCAGAAGATCGACATCCAGAAGCTAACCGAGAAGTTCACGATCGATCAAGTCAAGGAAATGCTCCGCGAA
ATCATTGACTCTTGCTACACACGTGCGAAGGAACAGCAGGCGGCTGAAGGCTACATCAAGCTCGAACGTGGATTC
GCAACGATTCCCTTACCCGGAATTGACGTACCCTTCCACTCACGTTACTTATGGGCTGGTGTCATGCCATTCCGA
GCTTACCTCTCGAAGAAGATTAACCCCGCGCAGCTCAATCCCGATACCTTGGTTGGCAAATATGTCCCGAATCTC
ATTGCCAAGCCCTTTGAGATCTCGAAGGACTACGTGCAGCTCATCTATGATCGCACCCTGTCTGTACGATTGGAC
AAGGTCCTCCGGAAGTGGGATCAAGACAACTGGGATGCACCGGAGCAGCGACAGAAGCTCGCCTATATCACGCTG
GTCGAGCTGCTCGCGTACCAGTTTGCGTCACCTGTACGATGGATCGAGACGCAGGATATCCTTTTCACGCGTTAC
CACTTCGAACGCTTCATCGAGATTGGACCGTCGCCGACGCTTACCGGTATGGCCACTCGCACTCTGAAGGCGAAG
TACGAGGTACAGGATGATTCAGTCAGCCGGACGCGTGCAATCTTGTGTCATGCGAAGAACACTAAGGAGGTCTAC
TACCAATTCGAGGATGCACCAGAAGTTGCGGAATCTGATGCACAGGCTGACAACGCGGCAATACAGGCTTCCGTT
GTTAGCACACCTATCGCTGTGTCTGCTGCCCCTGCGCCCGCTGCCAGTGCCACCCCGGCCACTAGCGTAGATGAT
GTTCCCCTGAAGGCCATCGAAATTCTCAGCGTCATCGTTGCGCAGAAGTTGAAGAAGAAAGTGGACGAAGTCCCA
TTGTCGAAATCGCTGAAGGACCTATCCGGTGGCAAGTCTACCCTTCAGAACGAGATCCTTGGTGACCTCCAACTC
GAGTTTGCGTCTGCTCCGGAGAAGGGTGAGGAGCTCCCTCTTGAGGAGCTAGGCTCTGCCTTGAGTGTGGGCTTC
TCTGGGAGTTTGGGCAAGTACACCTCTGGTCTCGTCGGACGTCTCGTTGGCGGCAAGATGCCTGGTGGATTCAAC
ATGTCTTCAATCAAGGCGTATCTTTCTAAGGCCTGGGGTCTCGGTCCTTCTCGTGCTGATGGCGTCCTCCTCCTT
GGTACCACTATGGAACCTGCTAAACGTCTCGCTTCAGAGGCGGACGCGAAGGCGTGGCTGGACTCGATCGTCGCG
TTGTATGCCCAGCGTGCCGGGATCTCCCTTTCTGCAGCCAGTACCTCTGGTAGTGGCGGAGGCGGTGGCGGCGGC
CCCACGATCAACAGTGAAGAATTCCTGAAATTCCAGGCGGAGCAGGAATGGTTCGCCTCGCAGCAGGTCGAATTA
TACATGCGATATCTCAAGCGCGACTCTCGAGCTGGCGAGCACAAGTATGAAAATGAGAAGGCCAATGTCGATGCG
CTTCAGTCAAGACTGGACGCCATCGCGAGAGAACACGGCGACACCTACATTGATGGAATTCAACCCGTCTTTGAC
GCTCTGAAGGCCCGCCACTTCGATTCTTCATGGAACTGGGTTCGTCAGGATGCACTCCTCATGTTCTACGACATC
ATCTTCGGCCGTCTTACTACTGTCGACCGGGAAATTACCGCGCGTTGCATCGCTATCATGAACCGCGCCGACCCA
GAGCTAGTGACGTACATGCAATACTATATTGACCAGTGTGATCCCAACCGTGGCGATACATACAAGCTGGCGAAA
CAGTTCGGCCAACAGCTCATCGACAACTGCCGTGAAGTGGTCGGTCTACCTCCTCTGTACAGGGATGTTACGTTC
CCAACGGCGCCGCACACCGAGGTGACTGCGAAGGGAGACATTGTCTACTCCGAGGTGGTTCGCGAGAACGTGCGC
AAGTTGGAGGCATATGTAGAGGAGATGGCCAGTGGTGACACTATTTCGGCTCCCACCAACATGCAGAAGATCCAA
GACGATGTTCTCAAGCTGTGGACCGTCGTCAAGTCTCAGCCGGAGATCAGCGAGGAGCAGAAGAACCGTATCAAG
GCTCTGTACGAAGGCGTCGTTCGATCTCTCCGCAAGCGTCCGGAGTCGCGCGCTCGTCCTGGAGCACCAAGGACT
CGCCGTTCGTCTTCGCAATTCCTTCGGCCCCAGATCTCTGGCATCGCATCCGTGTCTGCTGACAAGGTTCCACTC
TTGCACCTAAAGCGCAGAGTTGGTACAACTTGGGAGTACAGCAGCAACCTCACTGGTGTCTATCTCGACATCTTG
CATGAGATTGCCACGTCTGGCACTACGTTCAAGGACAAGAACGCTCTACTCACCGGTGTTGGTAAGGGATCAATC
GGAGTCGAAGTGCTCAAGGGACTTCTCTCTGGCGGAGCGCACGTTGTCATAACCACTTCTCGCTACAACCGGTCG
ACCGTCGAGTACTACCAGAGCGTCTTCCAGCGCTTTGGTAGCAAGGGATCTGGACTGACTGTTGTCCCCTTCAAC
CAAGGCTCCAAGCAAGACGTCGAAGCCCTCGTCGACTACATCTACTCTACCCTGGGCCTTGACCTTGACTATATT
CTCCCCTTCGCTGCCGTCCCTGAGAACGGGCGTGAGATTGATGGCTTGGATGACAAGTCTGAGCTCGCACACCGA
ATCATGCTGGTCAACCTCCTTCGTTTACTAGGCGCAGTCAAGGTGAAGAAGGCGTCTCGACATATCTTGACTCGA
CCCACTCAGGTGATCCTGCCCCTATCGCCCAACCACGGAACATTTGGACGGGATGGCCTCTACTCCGAATCCAAG
ATCGGTCTGGAGACGCTGTTTAACAGGTGGAATTCTGAGAGCTGGGGGGAGTACCTCTGTATGGCTGGCGCCGTT
ATAGGGTGGACTCGTGGCACGGGCTTAATGGACGCAACCAACATCGTAGCGCAGGAAGTCGAAGGCAACGGCGTG
CGCACCTTCTCCGCGAAGGAGATGGCCTTCAACCTCCTCGGCTTGATGCACCCCCTCTTGTTCAGCATTACCCAA
GTCGAACCGATCTGGGCCGATCTGAACGGTGGCATGGATCGTCTCCCTGATCTCGCTGAGATTACGACCCGTATA
CGTGGTGACCTCAACAAAAAGAGTGATCTTCGTCGTGCAATTGCTCGAGACAACGCAGCGGACTTCAAGGTCGTC
AACGGGGTCGAGGCCGAGCGCGTTCTCCAGACAGTGAACGTAACACCTCGCGCTAATTTCAAGTTCAATTTCCCT
TCACTAGAGTCTGTGGAGTCTTTATCCGATGTTGCTGCCCTCCGAGGAATGCTGGATCTTGACCAGGTTGTCGTC
GTAACAGGCTTCGCGGAAGTGGGGCCTTGGGGTAGTTCGCGTACCAGGTGGGAAATGGAAGCTCGCGGTGAATTC
ACTATCGAAGGCTGCATCGAGATGGCGTGGATGATGGGCTACATCAAGCACTTCGACGGGCGATTGAAGGACGGC
TCTCTGTACGTGGGTTGGGTTGACTCCAAGACTGAAGAACCTGTGGACGACAAGGATGTCAAGAGTCGCTACGAG
AAAGACATTCTCGGCCGTGCTGGGATTCGTCTCATCGAACCGGAGCTCTTCCGCGGATATGATCCCAAGAAGAAG
ACATTCAATCAAGAGATACAGTTGATTCATGATCTTGAAGCGTTCGAGGCGAGTCAGACTGAAGCTGAGAAGTTC
AAATACGAACACGGCGACAGCTGCGATATATGGGCTGGCGAGGGAGGACAGTGGTTCGTCAAGCTCAAGAAGGGT
GCGCGCGTCATGGTGCCGAAAGCCTTCAAGTTCAACCGTCTTGTCGCTGGTCAGATTCCTACCGGATGGCACGCT
GGTCGTTACGGTATCCCTGCGGACATCATCTCTCAAACCGACCGTACCGCTCTATGGACTCTGGTTGCAGCAGCA
GATGCGCTCAACACGTCCGGTATCACCGATCCGTACGAGTTGTACCAACACATGCATCCATCCGAGGTTGGCACT
AGCATTGGTAGCGGTATGGGCGGTATGGAAAGTCTGGCGAAGATGTTCAAGGACCGCCGAGACGAAAAGGACGTA
CAAAATGACATCCTGCAGGAGACGTTCATCAACACGACCGCAGGATGGGTCAATCTCCTTCTGCTTTCATCTTGT
GGACCAGTGAAGATTCCTGTCGGTGCCTGTGCGACTGCTCTGCAATCGGTAGAGATCGCTTGTGATACACTCTTA
TCCGGTAAAGCCAAAGTGATGCTGGCGGGAGGATACGATGACTTCAGCGAGGAAGGCTCCTACGAGTTCGCGAAC
ATGAAGGCCACTAGTAACTCGGAGACTGAGTTCGCTATGGGTCGAGAGCCAACAGAGATGTCGAGGCCTGCCACC
ACGACTCGTGGAGGATTCATGGAAGCACAAGGCACGGGTGTACACGTCCTCATGAGTGCGAAGACAGCGTTGGAA
ATGGGTTGCCCAATTCGTGGCATTGTCGCATTCACATCGACATCCACCGATAAGGCAGGAAGATCAGTCCCTGCT
CCAGGACGCGGTGCGCTCACCATCGCCAGAGAGATTCAGTCGAAACACCCTCTTCCTATTCTTGATATTGCATAC
CGTTCACGACAGCTCGCGTTCCGTCGTCGCCAGATTGCTGATTGGTTGGAGAATGAGCGACACCTACTGCAAGAG
GAGCTCGAGTTCCGAAAGAGTCACAACGAGCCCGCCAGCGGAGACTACCTCGCCAGTCGCGTAGTTGACCTAGAG
AAGGAGGCTGCCCGTCAGGAGAAGGATGCTTTGGCAACGTACGGCATGCTTCAAGGTGTTGACCCTCGAGTGTCC
CCTCTCCGTCGCGCACTAGCCGTCTGGGGGCTGACTGCAGACGACGTTGGCGTGCTGTCCATCCATGGTACCGGT
ACTGGTGCAAACGAGAACAATGAGACACACGTCTGGAATGATGTCTTCGCCAATATCTCTCGCACCCCGGGCAAC
GCTGTACCTGTCATGGCTCAGAAGAGTCTCTGCGGCCACTCCAAAGGTGGGTCAGCTGCATGGCAACTGGCCGGT
CTGCTTCAGAGCGTGGGAAGTGGTATCGTCGCGGGCAACAGAAATGCCGACAACGTGGACTCGCACTTCAAGGAC
TACACGTACTTGATGTTCCCGTCGGTGTCGATTCATACCGATGGCATCCGTGCAGGCCTTATGTCGTCATTCGGG
TTCGGTCAAGTCGGTGGAACTTGTCTCGTCTTGCATCCTCGCCACGTCTTCGGTGCCCTCGAGCCGTCTGCATAT
GAAACCTACAAGGCCAAGAATGCTCGCCGCTCCCGCCTCACATATAAGGCCATGAGTGAGATGATGATCACCAAC
TCATTGGTTCGGGTGAAGGAGGGCCCGCCTTTCACGAAGGACGTCGAGGCAGCCGTTATGCTTAACCCTCTCGCA
AGGACTTCCTACGATTCGAAGACGGGCAGCTATGTCTTCACGTCCAAGCTGGCCACGGAGCCTCAGGTCGATACG
GCTCACGTCAAGGCGGTCTCACAGATCATCTCGGAGAAGGAATCCACCGCAGGAGTCGGTGTCGACCAAGAACTG
ATCTCGTCGGTGCCGTCGTGGAATCCCGAGTTCGTTAAGCGCAACTTCACTGAGGCCGAAATTGCCTACTGCCGA
GGACAGCCGTCTTCTGAGTCTTCCTTCGCCGCACGGTGGGTCGGCAAGGAAGCCGTCTTCAAGTCGCTTGGTGTC
TCGTCGAAGGGTGCCGCGGCGCCGATGAAGGACATCGAGATCCTGCCCGACGAATCCGGCGTTCCTACGGTCACG
CTGCACGGCGACGCTAAGTCTGCGGCCGAGGCTAAGGGTATCTCGAAAGTCCATCTATCGCTCAGCCACTCAGAG
AATGTCGCCATCGCGTTTGCGCAAGCCACGTCTTCATGA
Gene >RhoplFPRL280|147_1
ATGGCCAGTACACGCCCAATCTTGATCCAGTCGGGTCCCACTAGAGTATGTAACAATCTCAATGTATTCGGTCAG
TTAGTCTGACCCTCTTCAGATTTCCATTCCCGTCTCCACGCAATGCGATGAGTGGACAGCGGCGGAGGTCCTTCG
CGATGAATTCTCCACTACCAACACCGTAGATACCCAAGTAGATGACACAACACAGGCGACCATAGAGCTTTTCGC
CCGTTTTCTTGGGTACAGCGCACAATACCTAGACGCGGATCCGCATCGCACAACGATCTTACTCCGAGGTGTGAA
GGAGTTTACATCCACCTACCTTTCGCAACAAGATGTGCACACGCTCGCGGCCGCATTCGACACTGACGTGCGCAA
GACCGTGCTCGCAAACTACTTCCGGGCGTTCGCCGCGCTGGAGGCAAAGAACATTTCTGAAATTCCTCGCGCGCC
ATCACCAGCGCTATTCACGACGCAAGACGCGTCAATCTATGCAATTTTTGGCGGCCAGGGGACGAACGAGGTCTA
TTTCGATGAGCTGCAAAACCTCTATGACACGTACACGCCGTACGTCGCGCCATTCATCACTTCACTAACGGAGGA
GGTGCTGCTGCCCCTGGCTGCGGAGTATGGACCTACGACATACTATGCGCACGGTCTTGACGTGCTCTCATGGCT
CACCGGCGCGAGGCCGCGCCCACCAACGGCATACCTGGCCTCCATCCCCGTCTCATTCCCCCTGATCGGCTTGAC
GCAGCTGACGCAATACTTGGTCGTCTGCCGGACGACCGGCCTGACGCCTGCAGAGATGCGGTCGCGGTTGGCTGG
TGCGACTGGCCATTCACAGGGGCTAGTCTCAGCGGTGGTCGTGGCAGCAGCGACTACAGTGTCGACGTTCGTCTC
AGAGTCGCTGAAGGCGATGAAGTGGCTCTTCTATTGCGGATACCGAGGACAGGAGGCATTCCCCGTGCTCGCACT
AGAGCCGAGCATTGTCGAAGACGCGATCGAGGGTGGAGAGGGTGCGCCGAGCCCAATGTTGTCCGTGACTGGCTT
GGGTTTGAAGGAGTTGGAGGGGCACATCTCGAAGACGAACGCACACCTACCGCCCAAGTCGCAGCTGCAGGTGTC
TCTACACAATGGTCCGAAGACCTTCGTCGTGACTGGCCCGGCACGCGCGCTTTATGGCCTAGTAACGCACCTGCG
CAAGGTTCGCGCGCCCAGTGGCCTCGATCAGAGCAAGGTTCCCTTCTCGCAGAGGAAGCCTGTATTCGCGGTGCG
CTTCCTGGTGGTCGGCGTCCCCTACCACAGCGAGTATCTCGCGGGAGTGACGAAGAAGATGTTCGAAGAGGATTT
GGAGGGCGAGGAGCTTTGGACGAAGGAGGATCTCGGAATTGCTGTCTATCACACAGAGAACGGTATGCAACTACT
GCGCAATGTTCCTGAGCGACGCTAACAGAAGCTATTCACGCCTAGGATCGGATTTGCGGGAGCTATCGACATCAT
TGACGTGCGCCTTGTGCGACCAAATCTTCACGCTCCCCATCCATTGGGCACAGGCAACTGACTTCCCTGAGACGG
CTACGCACGCGATTGACTTCGGTCCTGGCGGGCTCAGCGGCATCGGTCCTCTCACAGCGCGGAATCTGGACGGCC
GTGGCGTACGCGTCATCGTCGCGGGGGACAAGGCCAAGGGCATCGTCGAGTTGTATAACACGCAGAACGTGAAGC
GCGAGGAGTGGTGGGCGAAGAAGTTCACGCCCGGTCTTGTGAAGACTAGGTCAGTACACTGTCTTTATTTGCTGA
CGAACAGGCTTTAATGCGTTCACAGCGACGGCACCATCCACATCGATACCCCATTCTCTCGCCTGCTTGGCAAGC
CCCCAATCATGGTTGCTGGTATGACGCCGACTACTGTCCAAGCTGGTTTCGTTAGCGCGGTTCTCTCTGCTGGTT
ATCACGTCGAACTTGCCGGTGGTGGGCACTACAATCCCGCAGCCCTGCGCGCGAAGGTCGCCGAAATACAGGCGA
ATATTCCTGCTGGCGTCGGTCTGACGCTCAATGCTCTCTACATCAACCCTCGTCAGTTCGGCTTCCAATTCCCAC
TGTGGCAGGAGATGCGTCGGGAAGGTCTTCCCGTTGAGGGGTTCTGTGTCGCTGCGGGTATCCCAAGCACAGAGA
AGGCGGCCGAAATCATCGACGCTCTCAGGAGCGCAGGCATCCGTCATGTTTCCTTCAAGCCCGGCTCTGTCGACG
GCATCCGCCAGGTCGTGAATATCGCTGCGGCCAACCCCGACTTCCCCATTATCCTGCAGTGGACAGGCGGCCGCG
CAGGCGGTCACCATTCGTGTGAGGACTTCCACCAGCCGATTTTGTCGACATATAGCGCGATCCGCCAGCAGAGCA
ACATCTCGCTGGTCGGTGGTTCTGGCTTCGGTGGTGCCGACGACGTCTGGCCGTACCTCACGGGTGATTGGTCAG
TGGAGCGCTATGGCATGCAGCCAATGCCCTTCGACGGCTTCCTGTTCGCGAGTCGGGTCATGGTTGCGAAGGAGG
CGCACACGAGCTCCTCTGTGAAGGACCTCATCGTCGCTGCGAGTGGTGTCGATGACGCGCAGTGGGAAGGCACCT
ACGCGAAGGAGACCGGCGGCATCCTGACCGTCAAGTCGGAGCTTGGTGAACCGATCCACAAGGTTGCAACGCGTG
CCGTCAAGCTCTGGAAGGAGTTCGACGACACGGTGTTCAAGCTGCCAAAGGAGAAGCGCGTTGCGTGGCTGACAG
AGCGTCGGGCGGAAATTATCGGGAAGTTGAACAAGGACTTCTCCAAGCCGTGGTTCGGTTGGAAGAAAGACGGGT
CGGTGGTTGAGGACATCGCCGATATGACATACGAGGAGGTTGTCTTGCGCATGATTCGTTTGATGTATGTCGCGC
ATGAGGAGCGCTGGGTCGACACCTCGCTGAGGAACCTGACTGGCGACTGGCTTCGCCGCATTGAGGAGCGGTTTG
CGGGTGTGAACGGTGGCGGGGCGAAGTCATCTATCCTCCAATCATACACATCCCTCGACAAGCCCCAGGAATTCG
TCGCATCGTTCTTTAAGGCTTACCCGCTCGCGACCGAGCAGATTCTTGCCTCGGAGGACAAGGCCTTCTTCCTCG
CAATCTCTCAGCGCCCTGGTCAGAAGCCGGTTCCGTTCATCCCTATCCTTGATGCCAGCTTCGAGGTGTGGTTCA
AGAAGGTATGATTCACTCGGACATTTAATGCGTCACAGCTACTGATTTTCGAGTAGGACTCCCTGTGGGCAGCTG
AGGACATCGAGGCTGTCTTCGACCAAGACCCGCAGCGTGTTTGCATCCTTCAAGGCCCGGTCGCTGTCAAGCACT
CCATGAAGAAGGATGAGCCCATCAAGGAGATGCTGGACAACATCACGTCGATGCTCGTCCAGAAGCTGGCGGATC
GTCTCTACAATGGTGATCTGAGCCGCGTTCCTACTGTCGGCTATCTCAGTCCTTCCTCGTCGCCTATCTCTCACA
ATGCATTCGCTTCTCTTGGCGTTGAGCGTGCTGTCAAGGGCAATGCCATCACATATGTTGTCGGCGCGAACCTTC
CCGACGCTACGACTTGGCTAGAGACTCTGGCAGGACCAGGACAAACTTGGTGGAGGGCACTCCTTACATCGACTA
CCATCGTGCAAGGGATGTCCTACGTCGACAACCCAATGCGACGACTCTTCTCGCCTCGTCGTGGGCAAAAGGTCG
TTGTTGAGACTGATAAGGAGTCGCCTGTGGGAGTGTCTGTCTTCGGCGCTGCACGGTCTTATGGTCCGCACAAGG
CATCGTTCAAGGCAGTTGAAGTTAGCTTCGACAAATCGCAAAATGTCATTAACGTCACGCTATTCGAAGATCGTC
GCGATGCCTCCGTTCCTCTTCATCTACAATTTGTCTACAAGCCTGCGATGGGCTTCGCTCCCATCCACGAAATCG
CTGAAGATCGCAACAAGCGCATCAAGGACTTCTATTGGCGCTTGTGGTTCGGCGATGATCAGGTCCTCCCTGAGA
TCGACGTTCGGCAGACGTTCACCGGTCCTGACGTCACCATTAGTGCGGCCGAAGTTGAGAGTTTCTGCACAGTTG
TCGGCAACGACGGCGAGTCTTTCAAGACAGCTCGGGCAGACCATGTCCAAGCACCAATGGACTTTGCCATTGTTA
CGGGCTGGCAGGTGCGTTGCTATCCTTGCTTTATTCATGTCAAAGGATTAAGCAATTTTGCAGGCGATCATGAAA
GCGATCTTTCCCTCGTCGATCGATGGTGACATACTGAAGCTTGTTCATCTGTCTAACGGGTTCCGTATGGTCAAC
GGCGCGAGATCGTTCCAAGCGGGCGATGTTTGCAACGCGGAGGCTCGTATTGTCTCAGTTGTGAACAACGATGCA
GGGAAGGTCGTCAAAGTCAAGGGTTTCGTGATGCGCGGTGGCGAGCCTGTCGTTGAAGTTATATCATCGTTCCTC
TACCGTGGCCGCTTCGCCGACTTCGAGAATACCTTCGAATTGATCGAGGAGCCGGACTATTTCGTTGAGCTTGCA
ACAGATGCGGACATCGGTGTCCTCCAATCCAAGGAGTGGTTTGAATGGGATGACGAGACGAAGCCTATCCATACT
GGAACTACTCTCATCTTCCGCATCCAGTCCGACGTCACCTATCGCAACAAGACGTGTTTCAAATCTGTCTCGGTC
TCCGGTGATATCTTTGTTCGTGATCAGCTCAAGCGCCTCGTTAAGGTTGGGAGCGTCGATTTCCTCCAAGACGAC
AGCCGCGGCAATCCCGTGCTCGCCTACTTGCAGCGCCATGGTCAGCCTCAAGGACTTCCAAGCCCTCTTGCGAAC
GATGGCTACACGATGACGTCTACGGGTTCAACTATCTTCAATTCCCCTGCTACCAATGAGCCGTATTCCGTCGTT
TCGGGTGACTTCAACCCTATCCACATCAACCCGTACTTCTCGGATTATGCGTCGCTTCCTGGGACCATCACGCAC
GGCATGTGGTCAAGTGCTGCCACTAGACGCTATGTCGAGACAGTCGTCGCTCATGGCCGTCCTGACCGTGTTATT
GCGTATGTTCAATTTTTATCTCGATCAATCTCGTTTCTTACATATTTATTTATAGTTATGATGTTGCGTTCGTTG
GTATGATTCTCCCTCGGGATGAACTCAACGTCAAGCTCAAGCACGTTGCCATGCGTGACGGCAACATTGTCGTCA
AGGTCGAGACATTTAATTCGCAAGGAGAGAAGGTCCTGGAAGGCACCGCGGAGGTTGCGCAGCCTACCACTGTCT
ATGTATTCACCGGCCAAGGTTCGCAGGAGCCTGGTATGGGCATGGATCTCTACAACAATTCCCCTGCTGCTCGCT
CTGTGTGGGAGGCTGCCGACGCACACCTTACTGCTGTATACGGATTTTCGATCGTCGAGATTGTCAAGGCCAACC
CGAAAGAGAAGACGATCCATTTCGGTGGGATAAAGGGGCAGCAAATCCGTTCACGCTATATGGAGATGACTTACG
ACACCATGGACAAGGACGGTAACGTGAAGACGCTCCCTCTCTTCGGTGACATCAATGCCCGTACGCAGAGATATA
CCTTTAGCCATCCATCCGGCCTGTTGTACGCGACGCAGTTTGCGCAGATCGCACTTGTCGTGACTGAGCGTGCGG
CGTTCGAGGACATGCGCTCGAAAGGTTTGGTCCAAACTGGTGCTGCTTTCGCCGGTCACTCTTTGGGCGAATACT
CAGCTTTGGCTTCGATCGCGGATGTTCTGCCAATCTCGTCACTCGTCGACATCGTCTTCTACCGTGGTATCACCA
TGCAGCGCGCTGTGGAACGCGACACCCAGAACCGATCTAACTATGCAATGTGTGCCGTGAATCCTAGTCGCATCT
CGAAGTCGTTCACAGATGCTGCGCTCCGTGAAGTTGTGGATGATATCGCTCAACACACAGGTTGCCTTCTGGAAA
TTGTGAACTTCAACGTAGAGGTAAACTAATGTTATTACCTCGCTTGCGAGTGCTTGCTAACAAGCATTTGTAGGG
TCAACAATACGTCTGTGCCGGTGAACTGATCGCGCTGCAGACGATGACCAATGTCTTGAATTACCTGAAGGTCCA
GAAGATCGACATCCAGAAGGTATGTAATCATGTTTCGCGTTACGAACCATCGCTGATTTGAGTTATGTAGCTAAC
CGAGAAGTTCACGATCGATCAAGTCAAGGAAATGCTCCGCGAAATCATTGACTCTTGCTACACACGTGCGAAGGA
ACAGCAGGCGGCTGAAGGCTACATCAAGCTCGAACGTGGATTCGCAACGATTCCCTTACCCGGAATTGACGTACC
CTTCCACTCACGTTACTTATGGGCTGGTGTCATGCCATTCCGAGCTTGTAAGCCTTCATTGGTCAAGTTGCATAC
TCGTTTGGCTTATAGTCTTGCTCAGACCTCTCGAAGAAGATTAACCCCGCGCAGCTCAATCCCGATACCTTGGTT
GGCAAATATGTCCCGAATCTCATTGCCAAGCCCTTTGAGATCTCGAAGGACTACGTGCAGCTCATCTATGATCGC
ACCCTGTCTGTACGATTGGACAAGGTCCTCCGGAAGTGGGATCAAGACAACTGGGATGCACCGGAGCAGCGACAG
AAGCTCGCCTATATCACGCTGGTCGAGCTGCTCGCGTACCAGTTTGCGTCACCTGTACGATGGATCGAGACGCAG
GATATCCTTTTCACGCGTTACCACTTCGAACGCTTCATCGAGATTGGACCGTCGCCGACGCTTACCGGTATGGCC
ACTCGCACTCTGAAGGCGAAGTACGAGGTACAGGATGATTCAGTCAGCCGGACGCGTGCAATCTTGTGTCATGCG
AAGAACACTAAGGAGGTCTACTACCAATTCGAGGATGCACCAGAAGTTGCGGAATCTGATGCACAGGCTGACAAC
GCGGCAATACAGGCTTCCGTTGTTAGCACACCTATCGCTGTGTCTGCTGCCCCTGCGCCCGCTGCCAGTGCCACC
CCGGCCACTAGCGTAGATGATGTTCCCCTGAAGGCCATCGAAATTCTCAGCGTCATCGTTGCGCAGAAGTTGAAG
AAGAAAGTGGACGAAGTCCCATTGTCGAAATCGCTGAAGGACCTATCCGGTGGCAAGTCTACCCTTCAGAACGAG
ATCCTTGGTGACCTCCAACTCGAGTTTGCGTCTGCTCCGGAGAAGGGTGAGGAGCTCCCTCTTGAGGAGCTAGGC
TCTGCCTTGAGTGTGGGCTTCTCTGGGAGTTTGGGCAAGTACACCTCTGGTCTCGTCGGACGTCTCGTTGGCGGC
AAGATGCCTGGTGGATTCAACATGTCTTCAATCAAGGCGTATCTTTCTAAGGCCTGGGGTCTCGGTCCTTCTCGT
GCTGATGGCGTCCTCCTCCTTGGTACCACTATGGAACCTGCTAAACGTCTCGCTTCAGAGGCGGACGCGAAGGCG
TGGCTGGACTCGATCGTCGCGTTGTATGCCCAGCGTGCCGGGATCTCCCTTTCTGCAGCCAGTACCTCTGGTAGT
GGCGGAGGCGGTGGCGGCGGCCCCACGATCAACAGTGAAGAATTCCTGAAATTCCAGGCGGAGCAGGAATGGTTC
GCCTCGCAGCAGGTCGAATTATACATGCGATATCTCAAGCGCGACTCTCGAGCTGGCGAGCACAAGTATGAAAAT
GAGAAGGCCAATGTCGATGCGCTTCAGTCAAGACTGGACGCCATCGCGAGAGAACACGGCGACACCTACATTGAT
GGAATTCAACCCGTCTTTGACGCTCTGAAGGCCCGCCACTTCGATTCTTCATGGAACTGGGTTCGTCAGGATGCA
CTCCTCATGTTCTACGACATCATCTTCGGCCGTCTTACTACTGTCGACCGGGAAATTACCGCGCGTTGCATCGCT
ATCATGAACCGCGCCGACCCAGAGCTAGTGACGTACATGCAATACTATATTGACCAGTGTGATCCCAACCGTGGC
GATACATACAAGCTGGCGAAACAGTTCGGCCAACAGCTCATCGACAACTGCCGTGAAGTGGTCGGTCTACCTCCT
CTGTACAGGGATGGTAAGTTGTTTCACGTGCGACGCATTGCGCTTGCTAATCTACTTTGACTCGTTCTAGTTACG
TTCCCAACGGCGCCGCACACCGAGGTGACTGCGAAGGGAGACATTGTCTACTCCGAGGTGGTTCGCGAGAACGTG
CGCAAGTTGGAGGCATATGTAGAGGAGATGGCCAGTGGTGACACTATTTCGGCTCCCACCAACATGCAGAAGATC
CAAGACGATGTTCTCAAGCTGTGGACCGTCGTCAAGTCTCAGCCGGAGATCAGCGAGGAGCAGAAGAACCGTATC
AAGGCTCTGTACGAAGGCGTCGTTCGATCTCTCCGCAAGCGTCCGGAGTCGCGCGCTCGTCCTGGAGCACCAAGG
ACTCGCCGTTCGTCTTCGCAATTCCTTCGGCCCCAGATCTCTGGCATCGCATCCGTGTCTGCTGACAAGGTTCCA
CTCTTGCACCTAAAGCGCAGAGTTGGTACAACTTGGGAGTACAGCAGCAACCTCACTGGTGTCTATCTCGACATC
TTGCATGAGATTGCCACGTCTGGCACTACGTTCAAGGACAAGAACGCTCTACTCACCGGTGTTGGTAAGGGATCA
ATCGGAGTCGAAGTGCTCAAGGGACTTCTCTCTGGCGGAGCGCACGTTGTCATAACCACTTCTCGCTACAACCGG
TCGACCGTCGAGTACTACCAGAGCGTCTTCCAGCGCTTTGGTAGCAAGGGATCTGGACTGACTGTTGTCCCCTTC
AACCAAGGCTCCAAGCAAGACGTCGAAGCCCTCGTCGACTACATCTACTCTACCCTGGGCCTTGACCTTGACTAT
ATTCTCCCCTTCGCTGCCGTCCCTGAGAACGGGCGTGAGATTGATGGCTTGGATGACAAGTCTGAGCTCGCACAC
CGAATCATGCTGGTCAACCTCCTTCGTTTACTAGGCGCAGTCAAGGTGAAGAAGGCGTCTCGACATATCTTGACT
CGACCCACTCAGGTGATCCTGCCCCTATCGCCCAACCACGGAACATTTGGACGGGATGGCCTCTACTCCGAATCC
AAGATCGGTCTGGAGACGCTGTTTAACAGGTGGAATTCTGAGAGCTGGGGGGAGTACCTCTGTATGGCTGGCGCC
GTTATAGGGTATGTGTGATCAACGTTGTTTTGTATTTTCTACTGATAGCTTGTTTCAGGTGGACTCGTGGCACGG
GCTTAATGGACGCAACCAACATCGTAGCGCAGGAAGTCGAAGGCAACGGCGTGCGCACCTTCTCCGCGAAGGAGA
TGGCCTTCAACCTCCTCGGCTTGATGCACCCCCTCTTGTTCAGCATTACCCAAGTCGAACCGATCTGGGCCGATC
TGAACGGTGGCATGGATCGTCTCCCTGATCTCGCTGAGATTACGACCCGTATACGTGGTGACCTCAACAAAAAGA
GTGATCTTCGTCGTGCAATTGCTCGAGACAACGCAGCGGACTTCAAGGTCGTCAACGGGGTCGAGGCCGAGCGCG
TTCTCCAGACAGTGAACGTAACACCTCGCGCTAATTTCAAGTTCAATTTCCCTTCACTAGAGTCTGTGGAGTCTT
TATCCGATGTTGCTGCCCTCCGAGGAATGCTGGATCTTGACCAGGTTGTCGTCGTAACAGGCTTCGCGGAAGTGG
GGCCTTGGGGTAGTTCGCGTACCAGGTGGGAAATGGAAGCTCGCGGTGAATTCACTATCGAAGGCTGCATCGAGA
TGGCGTGGATGATGGGCTACATCAAGCACTTCGACGGGCGATTGAAGGACGGCTCTCTGTACGTGGGTTGGGTTG
ACTCCAAGACTGAAGAACCTGTGGACGACAAGGATGTCAAGAGTCGCTACGAGAAAGACATTCTCGGCCGTGCTG
GGATTCGTCTCATCGGTAAGTGCTGTCTCTATGTGAGTTGAACTTGAGCTCACTGGAGTCGTTTCAGAACCGGAG
CTCTTCCGCGGATATGATCCCAAGAAGAAGACATTCAATCAAGAGATACAGTTGATTCATGATCTTGAAGCGTTC
GAGGCGAGTCAGACTGAAGCTGAGAAGTTCAAATACGAACACGGCGACAGCTGCGATATATGGGCTGGCGAGGGA
GGACAGTGGTTCGTCAAGCTCAAGAAGGGTGCGCGCGTCATGGTGCCGAAAGCCTTCAAGTTCAACCGTCTTGTC
GCTGGTCAGATTCCTACCGGATGGCACGCTGGTCGTTACGGTATCCCTGCGGACATCATCTCTCAAACCGACCGT
ACCGCTCTATGGACTCTGGTTGCAGCAGCAGATGCGCTCAACACGTCCGGTATCACCGATCCGTACGAGTTGTAC
CAACACATGCATCCATCCGAGGTTGGCACTAGCATTGGTAGCGGTATGGGCGGTATGGAAAGTCTGGCGAAGATG
TTCAAGGACCGCCGAGACGAAAAGGACGTACAAAATGACATCCTGCAGGAGACGTTAGTTCATTCCCTGTCCTCT
TTTCACTGTTTTTCTCATCGGTCCCTTTCAGGTTCATCAACACGACCGCAGGATGGGTCAATCTCCTTCTGCTTT
CATCTTGTGGACCAGTGAAGATTCCTGTCGGTGCCTGGTAAGTGCCTGTGGTCTGCTATATAGCCCTTTTGTCTT
CTGACAAGGTATCAGTGCGACTGCTCTGCAATCGGTAGAGATCGCTTGTGATACACTCTTATCCGGTAAAGCCAA
AGTGATGCTGGCGGGAGGATACGATGACTTCAGCGAGGAAGGCTCCTACGAGTTCGCGAACATGAAGGCCACTAG
TAACTCGGAGACTGAGTTCGCTATGGGTCGAGAGCCAACAGAGATGTCGAGGCCTGCCACCACGACTCGTGGAGG
AGTGAGTCTTTGTCCAAGTGCAATCCACGATTGGTGTTGACTTACTCTGAACAGTTCATGGAAGCACAAGGCACG
GGTGTACACGTCCTCATGAGTGCGAAGACAGCGTTGGAAATGGGTTGCCCAATTCGTGGCATTGTCGCATTCACA
TCGACATCCACGTGCGTATATATTAACGCTATTTTCTACGCATAGCTAACACGGATATACAGCGATAAGGCAGGA
AGATCAGTCCCTGCTCCAGGACGCGGTGCGCTCACCATCGCCAGAGAGATTCAGTCGAAACACCCTCTTCCTATT
CTTGATATTGCATACCGTTCACGACAGCTCGCGTTCCGTCGTCGCCAGATTGCTGATTGGTTGGAGAATGAGCGA
CACCTACTGCAAGAGGAGCTCGAGTTCCGAAAGAGTCACAACGAGCCCGCCAGCGGAGACTACCTCGCCAGTCGC
GTAGTTGACCTAGAGAAGGAGGCTGCCCGTCAGGAGAAGGATGCTTTGGCAACGTACGGCATGCTTCAAGGTGTT
GACCCTCGAGTGTCCCCTCTCCGTCGCGCACTAGCCGTCTGGGGGCTGACTGCAGACGACGTTGGCGTGCTGTCC
ATCCATGGTACCGGTACTGGTGCAAACGTACGTGAACTACTCGTCGTATCGTAATCAGCCTCGCTAATAGTGGTA
GTTACACAGGAGAACAATGAGACACACGTCTGGAATGATGTCTTCGCCAATATCTCTCGCACCCCGGGCAACGCT
GTACCTGTCATGGCTCAGAAGAGTCTCTGCGGCCACTCCAAAGGTGGGTCAGCTGCATGGCAACTGGCCGGTCTG
CTTCAGAGCGTGGGAAGTGGTATCGTCGCGGGCAACAGAAATGCCGAGTAAGTGCTCGTTTGCATACTACTCCTG
CAGAGACCTGACTTGCTCCTAGCAACGTGGACTCGCACTTCAAGGACTACACGTACTTGATGTTCCCGTCGGTGT
CGATTCATACCGATGGCATCCGTGCAGGCCTTATGGTGCGTGCATTGCGCAAGTTCGAAGACTGCATAATACTTA
TGTGTTCTCTAGTCGTCATTCGGGTTCGGTCAAGTCGGTGGAACTTGTCTCGTCTTGCATCCTCGCCACGTCTTC
GGTGCCCTCGAGCCGTCTGCATATGAAACCTACAAGGCCAAGAATGCTCGCCGCTCCCGCCTCACATATAAGGCC
ATGAGTGAGATGATGATCACCAACTCATTGGTTCGGGTGAAGGAGGGCCCGCCTTTCACGAAGGACGTCGAGGCA
GCCGTTATGCTTAACCCTCTCGCAAGGACTTCCTACGATTCGAAGACGGGCAGCTATGTCTTCACGTCCAAGCTG
GCCACGGAGCCTCAGGTCGATACGGCTCACGTCAAGGCGGTCTCACAGATCATCTCGGAGAAGGAATCCACCGCA
GGAGTCGGTGTCGACCAAGGTCAGTCCTGCTTCCGCTTCTCGTGATTCGGCAGCGACTAATGCTCCCTCAGAACT
GATCTCGTCGGTGCCGTCGTGGAATCCCGAGTTCGTTAAGCGCAACTTCACTGAGGCCGAAATTGCCTACTGCCG
AGGACAGCCGTCTTCTGAGTCTTCCTTCGCCGCACGGTGGGTCGGCAAGGAAGCCGTCTTCAAGTCGCTTGGTGT
CTCGTCGAAGGGTGCCGCGGCGCCGATGAAGGACATCGAGATCCTGCCCGACGAATCCGGCGTTCCTACGGTCAC
GCTGCACGGCGACGCTAAGTCTGCGGCCGAGGCTAAGGGTATCTCGAAAGTCCATCTATCGCTCAGCCACTCAGA
GGTATGTCGCCTGCATTGTTCTCCCATTATGCTCCTCATGTTGATCAATGTGCCATAGAATGTCGCCATCGCGTT
TGCGCAAGCCACGTCTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail