Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|142_20
Gene name
LocationNODE_142:23439..24413
Strand-
Gene length (bp)974
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 2.2E-16 150 212
PF03908 Sec20 Sec20 7.4E-07 159 236

GO

GO Term Description Terminal node
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Yes
GO:0005484 SNAP receptor activity Yes
GO:0051179 localization No
GO:0016192 vesicle-mediated transport No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0030674 protein-macromolecule adaptor activity No
GO:0003674 molecular_function No
GO:0060090 molecular adaptor activity No
GO:0051234 establishment of localization No
GO:0048193 Golgi vesicle transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 218 235 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup5754
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|047000
Agaricus bisporus var bisporus H97 AgabiH97|047000
Rhodonia placenta FPRL280 RhoplFPRL280|142_20 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|142_20
MNSLYTLGVRQTNSIQADLERLRNGDKSAALLGQISASLAAMHRTVDDYDSMAKREIIKTKQEKAVMRVQKFRAD
YTELRAQFEQIKAESEAAVRSELLASSSSATPLTPATGDTRRRFMPGQPPSSSEISESPFRAGAVPMSSMREQHA
LHEHTFIQNTEAKLDDFIAQGRAVLDDLVDQRNVLKGTQRRLLDAANTLGLSRDVIGWIERRSTQDMYIFFGGAI
LTFVCFYLIWRYLG*
Coding >RhoplFPRL280|142_20
ATGAACTCGTTGTATACCCTTGGTGTTCGTCAGACAAATTCAATACAAGCCGACTTAGAGCGTTTGAGGAATGGT
GACAAGTCAGCAGCCCTATTAGGGCAGATCTCAGCGTCCCTCGCGGCGATGCACAGAACAGTGGACGACTATGAT
TCAATGGCGAAACGGGAGATCATTAAAACGAAGCAAGAGAAAGCCGTCATGCGAGTTCAGAAGTTCCGCGCAGAT
TATACGGAGCTACGCGCGCAGTTCGAGCAAATTAAGGCAGAGAGCGAAGCTGCAGTTCGCTCCGAACTATTAGCG
TCTTCTTCCTCAGCCACTCCCTTAACACCAGCAACAGGAGATACGCGCCGACGATTTATGCCTGGACAGCCACCA
TCGTCCTCAGAGATATCAGAGTCTCCCTTCCGTGCAGGCGCTGTGCCCATGTCATCAATGCGAGAACAACATGCA
CTACATGAGCATACCTTCATTCAAAATACAGAAGCAAAACTCGACGACTTCATTGCGCAGGGCAGAGCCGTTCTT
GACGACCTGGTCGATCAGCGGAATGTGCTCAAAGGCACACAACGACGTCTTTTGGATGCTGCGAATACATTGGGT
CTCAGTAGAGACGTCATTGGATGGATCGAGCGGCGGAGTACTCAGGATATGTATATTTTCTTTGGCGGTGCGATT
CTCACTTTTGTCTGCTTCTATCTCATCTGGAGGTATCTTGGCTGA
Transcript >RhoplFPRL280|142_20
ATGAACTCGTTGTATACCCTTGGTGTTCGTCAGACAAATTCAATACAAGCCGACTTAGAGCGTTTGAGGAATGGT
GACAAGTCAGCAGCCCTATTAGGGCAGATCTCAGCGTCCCTCGCGGCGATGCACAGAACAGTGGACGACTATGAT
TCAATGGCGAAACGGGAGATCATTAAAACGAAGCAAGAGAAAGCCGTCATGCGAGTTCAGAAGTTCCGCGCAGAT
TATACGGAGCTACGCGCGCAGTTCGAGCAAATTAAGGCAGAGAGCGAAGCTGCAGTTCGCTCCGAACTATTAGCG
TCTTCTTCCTCAGCCACTCCCTTAACACCAGCAACAGGAGATACGCGCCGACGATTTATGCCTGGACAGCCACCA
TCGTCCTCAGAGATATCAGAGTCTCCCTTCCGTGCAGGCGCTGTGCCCATGTCATCAATGCGAGAACAACATGCA
CTACATGAGCATACCTTCATTCAAAATACAGAAGCAAAACTCGACGACTTCATTGCGCAGGGCAGAGCCGTTCTT
GACGACCTGGTCGATCAGCGGAATGTGCTCAAAGGCACACAACGACGTCTTTTGGATGCTGCGAATACATTGGGT
CTCAGTAGAGACGTCATTGGATGGATCGAGCGGCGGAGTACTCAGGATATGTATATTTTCTTTGGCGGTGCGATT
CTCACTTTTGTCTGCTTCTATCTCATCTGGAGGTATCTTGGCTGA
Gene >RhoplFPRL280|142_20
ATGAACTCGTTGTATACCCTTGGTGTTCGTCAGACAAATTCAATACAAGCCGACTTAGAGCGTTTGAGGAATGGT
GACAAGTCAGCAGCCCTATTAGGTCTGTACGCTTCACCTCTTGTCAAATGCTCAGTGTAAGGGCCTTCATAAATA
CCAAATGGTTCTGATGTTTGACAGGGCAGATCTCAGCGTCCCTCGCGGCGATGCACAGAACAGTGGACGACTATG
ATTCAATGGCGAAACGGGAGATCATTAAAACGAAGCAAGAGAAAGCCGTCATGTGTGTATTGCTACTCGCTGTCA
TGCTCAGAAGTCCTCATCTCAGTACGACTATCCAGGCGAGTTCAGAAGTTCCGCGCAGATTATACGGAGCTACGC
GCGCAGTTCGAGCAAATTAAGGCAGAGGTTTGCATTCCAGGATGCTTCTCTGACCATGTACTGATCCACCCACCT
CATCGCCATGTTCACTTAGAGCGAAGCTGCAGTTCGCTCCGAACTATTAGCGTCTTCTTCCTCAGCCACTCCCTT
AACACCAGCAACAGGAGATACGCGCCGACGATTTATGCCTGGACAGCCACCATCGTCCTCAGAGATATCAGAGTC
TCCCTTCCGTGCAGGCGCTGTGCCCATGTCATCAATGCGAGAACAACATGCACTACATGAGCATACCTTCATTCA
AAATACAGAAGCAAAACTCGACGACTTCATTGCGCAGGGCAGAGCCGTTCTTGACGACCTGGTCGATCAGCGGAA
TGTGCTCAAAGGCACACAACGACGTCTTTTGGATGCTGCGAATACATTGGGTCTCAGTAGAGACGTCATTGGATG
GATCGAGCGGCGGAGGTAGGCACTTGGTTTTATTCAGTTGGACATGGTATAATGATGCTTCATGCAGTACTCAGG
ATATGTATATTTTCTTTGGCGGTGCGATTCTCACTTTTGTCTGCTTCTATCTCATCTGGAGGTATCTTGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail