Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|11_75
Gene name
LocationNODE_11:194476..199048
Strand-
Gene length (bp)4572
Transcript length (bp)3003
Coding sequence length (bp)3003
Protein length (aa) 1001

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15249 GLTSCR1 Conserved region of unknown function on GLTSCR protein 6.4E-28 651 769
PF13181 TPR_8 Tetratricopeptide repeat 2.7E-04 317 348
PF13181 TPR_8 Tetratricopeptide repeat 7.0E-05 351 382
PF13181 TPR_8 Tetratricopeptide repeat 3.8E-02 419 445
PF13176 TPR_7 Tetratricopeptide repeat 2.2E-02 319 343
PF04049 ANAPC8 Anaphase promoting complex subunit 8 / Cdc23 2.0E-10 12 187
PF13432 TPR_16 Tetratricopeptide repeat 1.3E-04 356 411

GO

GO Term Description Terminal node
GO:0030071 regulation of mitotic metaphase/anaphase transition Yes
GO:0005515 protein binding Yes
GO:0005680 anaphase-promoting complex Yes
GO:0003674 molecular_function No
GO:0140535 intracellular protein-containing complex No
GO:0005488 binding No
GO:1902494 catalytic complex No
GO:0010965 regulation of mitotic sister chromatid separation No
GO:1901990 regulation of mitotic cell cycle phase transition No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0007346 regulation of mitotic cell cycle No
GO:0051983 regulation of chromosome segregation No
GO:0065007 biological regulation No
GO:0033043 regulation of organelle organization No
GO:0010564 regulation of cell cycle process No
GO:1905818 regulation of chromosome separation No
GO:0000151 ubiquitin ligase complex No
GO:0033045 regulation of sister chromatid segregation No
GO:0032991 protein-containing complex No
GO:1901987 regulation of cell cycle phase transition No
GO:1902099 regulation of metaphase/anaphase transition of cell cycle No
GO:1990234 transferase complex No
GO:0033044 regulation of chromosome organization No
GO:0140513 nuclear protein-containing complex No
GO:0051726 regulation of cell cycle No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0050794 regulation of cellular process No
GO:0051128 regulation of cellular component organization No
GO:0050789 regulation of biological process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1637
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|046560
Agaricus bisporus var bisporus H97 AgabiH97|046560
Rhodonia placenta FPRL280 RhoplFPRL280|11_75 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|11_75
MTLSTVDAETATALRNAVRDCSERGLLSASKWASELLLSLPPSKRLPSASTQTSGPHAGSPPRPPPVTHAGASAG
AVSAPHSPAPIIQPRHPHAPPLSSLPDKTRLQELEWEAQDADHIAAARAMIDAKDLAGEKQALKDWYKLDIPINT
SLLDLLEMVKNATDPFLLFLKALFLRRLSRREEAIESALLSIAAYAWNWSAWTVLGECLGDGEEMFQVKTLNTLH
SPTDNELGLCDRLLSEDFFPRSLWVMSLRACVLYHMHDFQEAADQFTKVLAIDPYRIDDIDIYSNILYVTEDHRA
LSRIAHEFTVIDKDRPEVCCLIGNYYSLRNEHEKAIKYFKRATQLDRTYLSAWTLMGHEYVETKNSHAAIEAYRK
AVDVSRKDYRAWYGLGQAYELLSMHQYALHYYQHATALRPYDVRIWQAQGICYEEMGRPREAIECLKRALIGADP
QETVIHLKLAKLHNDLDEFAEAAAYHRRVAEVCRAANKAVAEYAKSGVYVARYHLIHGGGDIALAKEYLEAIASS
NAEEATSRSSSPSTASAPLSATTNDIRSGSYINGTQSAVTTPAPEPQIPTIASTSNLDAEHIVVDDDLPAAAVNG
TKKRDSRALDDDDSDPLRRRFKRKFEAHSPAYDEKEIGRATSLVQWLGYHQYGALYPDTETPFADAPDAVNRLLP
YHIFQHPREDLDGLATRPVFSKKGKGKASKADLLREEIAETRFALDCWRRKTALEKRFRRALIHGGERSSPDDQS
YFLEQSLLDDERQETVATQAELRTARAELEKLERERRAAAPPTPAPRQTRPYYSVSTTTPSSGYSAQYRYSYPYA
QGYGTSQYTFSPAFQTAPAYPTTPVASAGAYRSYTPATPTSSAPYTSPYSTTTTSTAPPATPTPSHYRGTTSAIP
VQLPESSLAALRAIGLEPLAPAPAGQPQPAAVLKSRSGTTMQLEINVGSLQPAQMSGLALILNALTSKGVTVDGN
ASANSSATSGMLSTSTSASSQSATS*
Coding >RhoplFPRL280|11_75
ATGACGCTCTCGACTGTCGATGCCGAGACCGCCACCGCCCTGAGAAACGCCGTGCGCGACTGTAGCGAGAGGGGG
TTGCTTTCCGCGTCCAAGTGGGCATCCGAACTACTCCTTTCCTTGCCACCCTCCAAAAGACTGCCATCGGCCTCA
ACGCAGACTTCAGGGCCCCATGCAGGTTCTCCCCCTCGGCCACCACCAGTCACACATGCTGGCGCCTCTGCAGGA
GCCGTATCAGCTCCACATTCCCCAGCCCCGATCATTCAGCCGAGACACCCTCATGCGCCTCCATTGAGCTCACTT
CCCGACAAGACTCGCCTGCAGGAGCTCGAGTGGGAGGCGCAGGATGCTGACCACATTGCTGCAGCCAGGGCCATG
ATTGATGCTAAGGACCTGGCTGGCGAAAAGCAAGCACTGAAGGACTGGTACAAGCTCGACATACCTATCAACACG
TCACTATTGGATCTCTTAGAGATGGTCAAGAATGCGACAGACCCGTTCTTGCTATTCTTAAAGGCTTTATTCCTA
CGTCGACTGTCACGACGCGAGGAAGCCATTGAGAGCGCCCTCCTATCAATCGCCGCATATGCTTGGAACTGGTCA
GCTTGGACTGTCCTTGGAGAATGCCTTGGAGACGGTGAAGAGATGTTCCAAGTCAAGACTCTGAACACACTGCAT
AGTCCCACTGACAATGAGCTGGGTCTTTGTGACCGCTTACTGAGCGAAGACTTCTTTCCCCGAAGTCTATGGGTC
ATGTCACTTCGGGCCTGCGTTCTGTACCACATGCATGACTTCCAGGAGGCAGCAGATCAGTTCACAAAAGTTTTA
GCCATCGATCCATACAGGATAGATGACATTGACATTTATTCTAATATCCTATATGTGACTGAGGATCATCGCGCA
TTGTCAAGAATTGCCCACGAATTCACCGTTATCGACAAGGATCGACCAGAGGTGTGCTGTCTCATCGGCAACTAC
TACTCATTGCGCAACGAGCACGAAAAGGCCATCAAGTACTTCAAACGTGCCACTCAGCTAGATCGGACATATCTT
TCCGCATGGACGCTCATGGGCCATGAATATGTGGAGACGAAAAATTCACATGCAGCTATCGAAGCCTATAGGAAA
GCTGTTGACGTAAGCCGGAAGGATTACAGAGCTTGGTATGGTCTGGGTCAGGCCTATGAGCTGCTGAGTATGCAT
CAATACGCCCTGCACTACTATCAGCACGCCACAGCGTTACGCCCATATGATGTCCGCATTTGGCAAGCACAGGGC
ATATGCTACGAAGAGATGGGGCGGCCTCGAGAAGCCATTGAATGTCTCAAGCGCGCGCTCATCGGCGCCGACCCA
CAGGAGACGGTAATCCACCTCAAGCTAGCCAAGCTGCACAACGATCTCGACGAGTTCGCCGAGGCTGCGGCATAC
CATCGCCGTGTGGCAGAGGTCTGCCGAGCTGCCAATAAAGCTGTCGCCGAGTATGCCAAGTCAGGAGTCTACGTC
GCGCGCTACCATCTGATCCACGGAGGAGGGGATATTGCATTGGCGAAGGAGTACCTGGAAGCGATTGCCTCAAGC
AATGCGGAGGAAGCCACTTCACGCTCTTCCTCGCCTTCAACCGCGTCTGCGCCGCTCTCGGCGACGACTAACGAT
ATACGATCTGGCTCGTACATCAATGGGACCCAATCCGCCGTTACTACCCCAGCACCAGAGCCACAAATCCCTACG
ATCGCGTCTACTTCGAATCTGGACGCAGAACACATAGTTGTAGACGACGATCTGCCCGCCGCCGCCGTCAATGGG
ACAAAGAAACGAGATTCTCGTGCTTTGGACGACGATGATTCTGATCCCCTGAGGCGGAGATTCAAGAGGAAATTC
GAAGCACACAGCCCCGCATACGACGAGAAAGAGATAGGGAGAGCGACAAGCCTTGTGCAGTGGTTGGGGTATCAC
CAATACGGCGCTCTCTACCCCGACACAGAGACACCGTTCGCCGATGCACCGGACGCCGTCAACCGTCTGCTTCCC
TATCATATCTTTCAGCATCCACGAGAAGACCTGGATGGCCTGGCGACTCGCCCAGTGTTCTCCAAGAAAGGGAAA
GGGAAAGCCTCAAAGGCCGATCTCTTGCGAGAAGAGATTGCTGAGACGCGATTTGCGCTAGACTGCTGGCGCCGC
AAAACTGCTCTCGAGAAGCGATTCAGGCGCGCCCTAATACACGGTGGAGAGCGGTCGTCTCCTGATGATCAGTCG
TACTTCCTGGAACAATCGCTCTTGGACGATGAGCGGCAAGAAACAGTCGCTACGCAGGCGGAGCTTCGAACTGCC
CGCGCCGAGCTGGAGAAATTGGAGCGCGAGCGACGCGCAGCTGCCCCTCCTACTCCTGCCCCCCGACAGACCCGG
CCATACTATTCAGTTTCTACAACAACGCCTTCATCTGGGTATTCTGCACAGTATCGGTACTCATATCCTTATGCA
CAAGGATATGGCACCTCACAGTACACCTTCTCCCCTGCATTCCAAACCGCCCCTGCATACCCGACGACACCTGTG
GCTAGCGCCGGCGCTTATCGTAGCTATACCCCGGCAACGCCGACGTCGTCTGCACCATACACATCCCCGTACTCA
ACTACAACTACATCCACTGCGCCACCGGCAACACCGACACCGAGCCACTATCGTGGAACAACATCTGCGATTCCT
GTACAGTTGCCAGAGAGCTCGCTTGCCGCGCTCAGGGCAATTGGATTGGAACCCCTAGCCCCAGCCCCGGCGGGG
CAGCCTCAGCCGGCAGCGGTCCTGAAAAGCCGGTCGGGCACGACGATGCAGTTGGAGATCAACGTCGGATCTCTA
CAGCCGGCTCAGATGAGCGGACTTGCGCTAATTCTAAACGCGTTGACGTCAAAGGGCGTCACTGTGGACGGCAAT
GCGAGCGCCAACTCGAGCGCCACCTCTGGAATGTTGTCGACCTCGACGTCGGCGTCGTCGCAGAGCGCGACGTCC
TGA
Transcript >RhoplFPRL280|11_75
ATGACGCTCTCGACTGTCGATGCCGAGACCGCCACCGCCCTGAGAAACGCCGTGCGCGACTGTAGCGAGAGGGGG
TTGCTTTCCGCGTCCAAGTGGGCATCCGAACTACTCCTTTCCTTGCCACCCTCCAAAAGACTGCCATCGGCCTCA
ACGCAGACTTCAGGGCCCCATGCAGGTTCTCCCCCTCGGCCACCACCAGTCACACATGCTGGCGCCTCTGCAGGA
GCCGTATCAGCTCCACATTCCCCAGCCCCGATCATTCAGCCGAGACACCCTCATGCGCCTCCATTGAGCTCACTT
CCCGACAAGACTCGCCTGCAGGAGCTCGAGTGGGAGGCGCAGGATGCTGACCACATTGCTGCAGCCAGGGCCATG
ATTGATGCTAAGGACCTGGCTGGCGAAAAGCAAGCACTGAAGGACTGGTACAAGCTCGACATACCTATCAACACG
TCACTATTGGATCTCTTAGAGATGGTCAAGAATGCGACAGACCCGTTCTTGCTATTCTTAAAGGCTTTATTCCTA
CGTCGACTGTCACGACGCGAGGAAGCCATTGAGAGCGCCCTCCTATCAATCGCCGCATATGCTTGGAACTGGTCA
GCTTGGACTGTCCTTGGAGAATGCCTTGGAGACGGTGAAGAGATGTTCCAAGTCAAGACTCTGAACACACTGCAT
AGTCCCACTGACAATGAGCTGGGTCTTTGTGACCGCTTACTGAGCGAAGACTTCTTTCCCCGAAGTCTATGGGTC
ATGTCACTTCGGGCCTGCGTTCTGTACCACATGCATGACTTCCAGGAGGCAGCAGATCAGTTCACAAAAGTTTTA
GCCATCGATCCATACAGGATAGATGACATTGACATTTATTCTAATATCCTATATGTGACTGAGGATCATCGCGCA
TTGTCAAGAATTGCCCACGAATTCACCGTTATCGACAAGGATCGACCAGAGGTGTGCTGTCTCATCGGCAACTAC
TACTCATTGCGCAACGAGCACGAAAAGGCCATCAAGTACTTCAAACGTGCCACTCAGCTAGATCGGACATATCTT
TCCGCATGGACGCTCATGGGCCATGAATATGTGGAGACGAAAAATTCACATGCAGCTATCGAAGCCTATAGGAAA
GCTGTTGACGTAAGCCGGAAGGATTACAGAGCTTGGTATGGTCTGGGTCAGGCCTATGAGCTGCTGAGTATGCAT
CAATACGCCCTGCACTACTATCAGCACGCCACAGCGTTACGCCCATATGATGTCCGCATTTGGCAAGCACAGGGC
ATATGCTACGAAGAGATGGGGCGGCCTCGAGAAGCCATTGAATGTCTCAAGCGCGCGCTCATCGGCGCCGACCCA
CAGGAGACGGTAATCCACCTCAAGCTAGCCAAGCTGCACAACGATCTCGACGAGTTCGCCGAGGCTGCGGCATAC
CATCGCCGTGTGGCAGAGGTCTGCCGAGCTGCCAATAAAGCTGTCGCCGAGTATGCCAAGTCAGGAGTCTACGTC
GCGCGCTACCATCTGATCCACGGAGGAGGGGATATTGCATTGGCGAAGGAGTACCTGGAAGCGATTGCCTCAAGC
AATGCGGAGGAAGCCACTTCACGCTCTTCCTCGCCTTCAACCGCGTCTGCGCCGCTCTCGGCGACGACTAACGAT
ATACGATCTGGCTCGTACATCAATGGGACCCAATCCGCCGTTACTACCCCAGCACCAGAGCCACAAATCCCTACG
ATCGCGTCTACTTCGAATCTGGACGCAGAACACATAGTTGTAGACGACGATCTGCCCGCCGCCGCCGTCAATGGG
ACAAAGAAACGAGATTCTCGTGCTTTGGACGACGATGATTCTGATCCCCTGAGGCGGAGATTCAAGAGGAAATTC
GAAGCACACAGCCCCGCATACGACGAGAAAGAGATAGGGAGAGCGACAAGCCTTGTGCAGTGGTTGGGGTATCAC
CAATACGGCGCTCTCTACCCCGACACAGAGACACCGTTCGCCGATGCACCGGACGCCGTCAACCGTCTGCTTCCC
TATCATATCTTTCAGCATCCACGAGAAGACCTGGATGGCCTGGCGACTCGCCCAGTGTTCTCCAAGAAAGGGAAA
GGGAAAGCCTCAAAGGCCGATCTCTTGCGAGAAGAGATTGCTGAGACGCGATTTGCGCTAGACTGCTGGCGCCGC
AAAACTGCTCTCGAGAAGCGATTCAGGCGCGCCCTAATACACGGTGGAGAGCGGTCGTCTCCTGATGATCAGTCG
TACTTCCTGGAACAATCGCTCTTGGACGATGAGCGGCAAGAAACAGTCGCTACGCAGGCGGAGCTTCGAACTGCC
CGCGCCGAGCTGGAGAAATTGGAGCGCGAGCGACGCGCAGCTGCCCCTCCTACTCCTGCCCCCCGACAGACCCGG
CCATACTATTCAGTTTCTACAACAACGCCTTCATCTGGGTATTCTGCACAGTATCGGTACTCATATCCTTATGCA
CAAGGATATGGCACCTCACAGTACACCTTCTCCCCTGCATTCCAAACCGCCCCTGCATACCCGACGACACCTGTG
GCTAGCGCCGGCGCTTATCGTAGCTATACCCCGGCAACGCCGACGTCGTCTGCACCATACACATCCCCGTACTCA
ACTACAACTACATCCACTGCGCCACCGGCAACACCGACACCGAGCCACTATCGTGGAACAACATCTGCGATTCCT
GTACAGTTGCCAGAGAGCTCGCTTGCCGCGCTCAGGGCAATTGGATTGGAACCCCTAGCCCCAGCCCCGGCGGGG
CAGCCTCAGCCGGCAGCGGTCCTGAAAAGCCGGTCGGGCACGACGATGCAGTTGGAGATCAACGTCGGATCTCTA
CAGCCGGCTCAGATGAGCGGACTTGCGCTAATTCTAAACGCGTTGACGTCAAAGGGCGTCACTGTGGACGGCAAT
GCGAGCGCCAACTCGAGCGCCACCTCTGGAATGTTGTCGACCTCGACGTCGGCGTCGTCGCAGAGCGCGACGTCC
TGA
Gene >RhoplFPRL280|11_75
ATGACGCTCTCGACTGTCGATGCCGAGACCGCCACCGCCCTGAGAAACGCCGTGCGCGACTGTAGCGAGAGGGGG
TTGCTTTCCGCGTCCAAGTGGTCAGTTTTGGGCTGCTATGATCAGAGCTTGATTATGACTCGTTGTCTCGCTTGG
CAGGGCATCCGAACTACTCCTTTCCTTGCCACCCTCCAAAAGACTGCCATCGGCCTCAACGCAGACTTCAGGGCC
CCATGCAGGTTCTCCCCCTCGGCCACCACCAGTCACACATGCTGGCGCCTCTGCAGGAGCCGTATCAGCTCCACA
TTCCCCAGCCCCGATCATTCAGCCGAGACACCCTCATGCGCCTCCATTGAGCTCACTTCCCGACAAGACTCGCCT
GCAGGAGCTCGAGTGGGAGGCGCAGGATGCTGACCACATTGCTGCAGCCAGGGCCATGATTGATGCTAAGGACCT
GGTCAGAGCTGTGCACTGGCTAAAGCCTTGTAAGAGTGCCAAAGGCCGCTTTCTCAGTGTTTACAGTCAATATCT
GGTAATTATCTATCGTTGTACTTCCCTACAACTCTGTTGTGATTTTCGACCCCAAGGCTGGCGAAAAGCAAGCAC
TGAAGGACTGGTACAAGCTCGACAGTGAGTGATGGGTCTTCAGTCATGTAAGCTTCAGCCTTCTTGAGTCTATGT
CTGCAGAGACACGATTCCAATCACCAGTACCTATCAACACGTCACTATTGGATCTCTTAGAGATGGTCAAGAATG
CGACAGACCCGTTCTTGCTATTCTTGTAGGGTTCAACAATTACTCTGCTACACCCGCCGACATGTAATGAAGTTG
AGCATTCTACAGAAAGGCTTTATTCCTACGTCGACTGTCACGACGCGAGGAAGCCATTGAGAGCGCCCTCCTATC
AATCGCCGCATATGCTTGGAACTGGTCAGCTTGGACTGTCCTTGGAGAATGCCTTGGAGACGGTGAAGAGGTAAT
CGCCAGTACCTTATCAGGGCATGCGCTGACATGACCTGTAGCTGTCTTCCATCTTGCCGTTGCTTCCAATTCCAC
CAACACATCCTTTGGTGCAGATGTTCCAAGTCAAGACTCTGAACACACTGCATAGTCCCACTGACAATGAGCTGG
GTCTTTGTGACCGCTTACTGAGCGAAGACTTCTTTCCCCGAAGTCTATGGGTCATGTCACTTCGGGCCTGCGTTC
TGTACCACATGCATGGTCCGTGTGGTCCGTACATACATCAGTATGTGCGGCAACTAACAATTGCATTCCAGACTT
CCAGGAGGCAGCAGATCAGTTCACAAAAGTTTTAGCCATCGATCCATACAGGATAGATGACATTGACATTTATTC
TAATATCCTATATGTGACTGAGGATCATCGCGCATTGTCAAGAATTGCCCACGAATTCACCGTTATCGACAAGGA
TCGACCAGAGGTGTGCTGTCTCATCGGTACGATCTATGGCGGTGATTTCCTGCAACCAATCGCATCATGATCATG
GCTCTCCCTTTTGCAGGCAACTACTACTCATTGCGCAACGAGCACGAAAAGGCCATCAAGTACTTCAAACGTGCC
ACTCAGCTAGATCGGACATATCTTTCCGCATGGACGCTCATGGGCCATGAATATGTGGAGACGAAAAATTCACAT
GCAGCTATCGAAGCCTATAGGAAAGCTGTTGGTAAGTTCAGGCACCATATCACAAGCTCCACCCAAACTATACAG
TTGCTGTCCACGTTCGTTGATTTTCTGATACTTCAGACGTAAGCCGGAAGGATTACAGAGCTTGGTATGGTCTGG
GTCAGGCCTATGAGCTGCTGAGTATGCATCAATACGCCCTGCACTACTATCAGCACGCCACAGCGTTACGGTATG
TCCGATCATGTTCTGTGCTCCCTTATCACTTCTTCCGCTCCATTATCGACCCTGCATGCTCATTGTTTGCATCCG
ACCGCTGTATTCATAGCCCATATGATGTCCGCATTTGGCAAGCACAGGGCATATGCTACGAAGAGATGGGGCGGT
AAGTGCGACCGCTCCTGGCTCGATTGTCGGACCCTGAGGCGTTAAGCCACACAAAACCTTGACAGGCCTCGAGAA
GCCATTGAATGTCTCAAGCGCGCGCTCATCGGCGCCGACCCACAGGAGACGGTAATCCACCTCAAGCTAGCCAAG
CTGCACAACGATCTCGACGAGTTCGCCGAGGCTGCGGCATACCATCGCCGTGTGGCAGAGGTCTGCCGAGCTGCC
AGTACGTCTCTCTTCTTACTTCACCCGCCTTGATGCCTTCTCTTTCGACCACAATGTACCTTTACGATTGCCGCC
CACCGCTTCTTATGTTTTTCTGCTCCAATCCACCTTCGTATGCTGACCGGATCACTATCGTGACTTCCGCTCCTC
TATTTCCATGCCAGATAAAGCTGTCGCCGAGTATGCCAAGTCAGGAGTCTACGTCGCGCGCTACCATCTGATCCA
CGGAGGAGGGGATATTGCATTGGCGAAGGAGTACCTGGAAGCGATTGCCTCAAGCAATGCGGAGGAAGTGGGTCA
GGCGACTGAGATGTTGAGAAGAGCAAAATTGTTGCAGGCCAAGTTGTTGGAGGCAGGCCTGGCCCAGGGGCAAAC
TCAAGCTCATATTAATGCTGCTGCGGGATCTAGTCAGGCGGGGGGAGCATTGCCATGACCCGAACAGTGCTTCTG
ACGTACATGCCCAATAGCTCGCGGAGATTACTCGGTGTACAGTAGGTTTTTCTGGAGAAAGTTCAGTTTGCGGTT
GTATAATACTGCTGGCGCAGCAATTTCGTTACACACGAACCCTAGCTGACCGGGACCAGTGGCGGAGCTTCATAA
GCGTCCGTTCTCAAGGCGATCAAATCTGGATATGATGGGCCACCATTCTCACGGTCACGCGGTCACGGGTGCACG
TACAGCGGTAAACGCAACAAAACAAACAAATCCGCCACGCCTGAGATGTCGAAAATTCAGGCCACTTCACGCTCT
TCCTCGCCTTCAACCGCGTCTGCGCCGCTCTCGGCGACGACTAACGATATACGATCTGGCTCGTACATCAATGGG
ACCCAATCCGCCGTTACTACCCCAGCACCAGAGCCACAAATCCCTACGATCGCGTCTACTTCGAATCTGGACGCA
GAACACATAGTTGTAGACGACGATCTGCCCGCCGCCGCCGTCAATGGGACAAAGAAACGAGATTCTCGTGCTTTG
GACGACGATGATTCTGATCCCCTGAGGCGGAGATTCAAGAGGAAATTCGAAGCACACAGCCCCGCATACGACGAG
AAAGAGATAGGGAGAGCGACAAGGTGAGATCTCAAGCATGTTCATTTGGTATCTTTGAAATAACCATTCGTCCTG
GTAGCCTTGTGCAGTGGTTGGGGTATCACCAATACGGCGCTCTCTACCCCGACACAGAGACACCGTTCGCCGATG
CACCGGACGCCGTCAACCGTCTGCTTCCCTATCATATCTTTCAGCATCCACGAGAAGACCTGGATGGCCTGGCGA
CTCGCCCAGTGTTCTCCAAGAAAGGGAAAGGGAAAGCCTCAAAGGCCGATCTCTTGCGAGAAGAGATTGCTGGTG
GGTTTTCCGCACCATCATGTTCCCACTCCCACTCAAGCGGTCTCATGGTACAGAGACGCGATTTGCGCTAGACTG
CTGGCGCCGCAAAACTGCTCTCGAGAAGCGATTCAGGCGCGCCCTAATACACGGTGGAGAGGTCTGTCCTTAATG
TGGCTGTAAGTAAGAACAGCACCAACTGATTCTCTTGGCACGTAGCGGTCGTCTCCTGATGATCAGTCGTACTTC
CTGGAACAATCGCTCTTGGACGATGAGCGGCAAGAAACAGTCGCTACGCAGGCGGAGCTTCGAACTGCCCGCGCC
GAGCTGGAGAAATTGGAGCGCGAGCGACGCGCAGCTGCCCCTCCTACTCCTGCCCCCCGACAGACCCGGCCATAC
TATTCAGTTTCTACAACAACGCCTTCATCTGGGTATTCTGCACAGTATCGGTACTCATATCCTTATGCACAAGGA
TATGGCACCTCACAGTACACCTTCTCCCCTGCATTCCAAACCGCCCCTGCATACCCGACGACACCTGTGGCTAGC
GCCGGCGCTTATCGTAGCTATACCCCGGCAACGCCGACGTCGTCTGCACCATACACATCCCCGTACTCAACTACA
ACTACATCCACTGCGCCACCGGCAACACCGACACCGAGCCACTATCGTGGAACAACATCTGCGATTCCTGTACAG
TTGCCAGAGAGCTCGCTTGCCGCGCTCAGGGCAATTGGATTGGAACCCCTAGCCCCAGCCCCGGCGGGGCAGCCT
CAGCCGGCAGCGGTCCTGAAAAGCCGGTCGGGCACGACGATGCAGTTGGAGATCAACGTCGGATCTCTACAGCCG
GCTCAGATGAGCGGACTTGCGCTAATTCTAAACGCGTTGACGTCAAAGGGCGTCACTGTGGACGGCAATGCGAGC
GCCAACTCGAGCGCCACCTCTGGAATGTTGTCGACCTCGACGTCGGCGTCGTCGCAGAGCGCGACGTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail