Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|117_7
Gene name
LocationNODE_117:56785..58925
Strand+
Gene length (bp)2140
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor 4.7E-34 29 119
PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop 1.1E-32 149 360
PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1 4.0E-24 388 509

GO

GO Term Description Terminal node
GO:0031124 mRNA 3'-end processing Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0031123 RNA 3'-end processing No
GO:0006397 mRNA processing No
GO:0016071 mRNA metabolic process No
GO:0008152 metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0046483 heterocycle metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|117_7
MSGLGLLNSDSKPLPADDEAAANTRQWDLASETEYRFELDPNSSLAIKLVHGQAEIFGAELAEGNTYVFGLECKA
AVYTWQGCTIEVTGQPSTEYVSEETPMQVYANLVLALEQMRVRALRAFHGSPPSSEEGPDPDPDPQPPRVLVLGP
ANSGKTTLSKMLINYAVRMGQSWNPVLVNVDPGEGGWAAPGAISAATITSPIQTSTPASTFGSAATSAPAHLTSN
ALLPLAYWYGHAETRRNPLLMDRLIRNLGENIWERWDNDLEGRVAGLIVDTPSSFAASSGPNGDHRHALIKACVD
AFRINVILIVGHEKLNVEMQRAYGNRIAVVKIPKSGGVVELDPSYRERARKHQLHNYMYGRIIPPPPGLPPTNVL
QGGEQTPDLTLNLAPSSSIVAFGDLTLYRIGEETMAPTSALPIGATRVVSEMQPLLVDPAQPGSGLYNAVLALLA
PPNPDESERYDEEMLDLPVVGFLVITTLDIPNKRMTVLAPTQGSLVGRTAIVGSIEWQE*
Coding >RhoplFPRL280|117_7
ATGTCGGGACTAGGTCTGCTAAATAGTGATAGCAAGCCCCTTCCAGCCGACGATGAGGCGGCTGCGAATACGCGG
CAATGGGATCTTGCCTCCGAGACTGAGTACAGATTTGAACTCGATCCAAACAGCTCTTTAGCGATCAAGCTCGTA
CATGGTCAAGCAGAAATTTTTGGTGCCGAACTTGCCGAGGGCAACACCTATGTATTCGGCCTCGAATGCAAGGCA
GCCGTGTATACATGGCAAGGTTGCACAATAGAGGTCACAGGCCAGCCATCCACGGAGTATGTCTCTGAGGAGACT
CCCATGCAGGTTTACGCCAACCTGGTCCTTGCACTCGAACAGATGCGCGTAAGAGCCCTGCGAGCCTTCCACGGC
TCTCCCCCATCTTCAGAGGAAGGACCCGACCCAGACCCGGATCCCCAACCACCACGCGTTCTCGTTTTAGGACCG
GCGAATTCTGGCAAGACCACGCTATCAAAAATGCTCATCAACTATGCCGTCCGTATGGGTCAGAGCTGGAATCCA
GTCCTGGTCAACGTCGATCCCGGTGAGGGTGGCTGGGCAGCACCAGGTGCAATCTCTGCCGCAACCATTACGTCA
CCAATACAGACATCTACACCGGCATCAACATTTGGCTCGGCCGCTACATCCGCTCCTGCACATCTCACCTCCAAT
GCCCTCCTTCCCTTAGCATATTGGTATGGCCACGCGGAAACTCGGCGCAACCCACTCCTGATGGACCGGCTGATA
CGTAATCTCGGTGAGAATATCTGGGAGCGGTGGGACAATGACCTCGAAGGACGTGTTGCGGGACTCATCGTCGAC
ACACCCTCATCATTCGCGGCAAGCTCGGGTCCCAATGGGGACCATCGACACGCCCTTATCAAAGCCTGCGTGGAT
GCATTTCGAATCAACGTCATTCTCATCGTCGGGCACGAGAAGCTGAACGTCGAGATGCAGCGAGCATACGGTAAC
CGCATCGCCGTCGTCAAAATCCCCAAATCGGGCGGGGTCGTCGAGCTCGACCCGAGCTACCGCGAGCGCGCGCGC
AAGCACCAGCTCCACAACTACATGTACGGCAGGATCATCCCGCCCCCGCCGGGCCTCCCGCCCACGAACGTCCTC
CAGGGCGGCGAGCAGACGCCCGACCTCACGCTCAACCTCGCGCCGTCCTCGTCTATCGTCGCCTTCGGCGACCTC
ACGCTCTACCGCATCGGCGAAGAGACGATGGCGCCCACGTCCGCGCTCCCCATCGGCGCGACGCGCGTCGTGTCC
GAGATGCAGCCGCTCCTCGTGGACCCCGCGCAGCCGGGCTCGGGCCTCTACAACGCGGTCCTGGCGCTGCTCGCG
CCGCCGAACCCGGACGAGTCGGAGCGCTACGACGAAGAGATGCTCGACCTCCCCGTCGTCGGGTTTCTGGTGATC
ACGACGCTGGACATTCCCAACAAGCGCATGACCGTGCTTGCGCCGACGCAGGGCTCTCTGGTCGGTCGGACCGCC
ATTGTCGGCTCGATCGAGTGGCAAGAATGA
Transcript >RhoplFPRL280|117_7
ATGTCGGGACTAGGTCTGCTAAATAGTGATAGCAAGCCCCTTCCAGCCGACGATGAGGCGGCTGCGAATACGCGG
CAATGGGATCTTGCCTCCGAGACTGAGTACAGATTTGAACTCGATCCAAACAGCTCTTTAGCGATCAAGCTCGTA
CATGGTCAAGCAGAAATTTTTGGTGCCGAACTTGCCGAGGGCAACACCTATGTATTCGGCCTCGAATGCAAGGCA
GCCGTGTATACATGGCAAGGTTGCACAATAGAGGTCACAGGCCAGCCATCCACGGAGTATGTCTCTGAGGAGACT
CCCATGCAGGTTTACGCCAACCTGGTCCTTGCACTCGAACAGATGCGCGTAAGAGCCCTGCGAGCCTTCCACGGC
TCTCCCCCATCTTCAGAGGAAGGACCCGACCCAGACCCGGATCCCCAACCACCACGCGTTCTCGTTTTAGGACCG
GCGAATTCTGGCAAGACCACGCTATCAAAAATGCTCATCAACTATGCCGTCCGTATGGGTCAGAGCTGGAATCCA
GTCCTGGTCAACGTCGATCCCGGTGAGGGTGGCTGGGCAGCACCAGGTGCAATCTCTGCCGCAACCATTACGTCA
CCAATACAGACATCTACACCGGCATCAACATTTGGCTCGGCCGCTACATCCGCTCCTGCACATCTCACCTCCAAT
GCCCTCCTTCCCTTAGCATATTGGTATGGCCACGCGGAAACTCGGCGCAACCCACTCCTGATGGACCGGCTGATA
CGTAATCTCGGTGAGAATATCTGGGAGCGGTGGGACAATGACCTCGAAGGACGTGTTGCGGGACTCATCGTCGAC
ACACCCTCATCATTCGCGGCAAGCTCGGGTCCCAATGGGGACCATCGACACGCCCTTATCAAAGCCTGCGTGGAT
GCATTTCGAATCAACGTCATTCTCATCGTCGGGCACGAGAAGCTGAACGTCGAGATGCAGCGAGCATACGGTAAC
CGCATCGCCGTCGTCAAAATCCCCAAATCGGGCGGGGTCGTCGAGCTCGACCCGAGCTACCGCGAGCGCGCGCGC
AAGCACCAGCTCCACAACTACATGTACGGCAGGATCATCCCGCCCCCGCCGGGCCTCCCGCCCACGAACGTCCTC
CAGGGCGGCGAGCAGACGCCCGACCTCACGCTCAACCTCGCGCCGTCCTCGTCTATCGTCGCCTTCGGCGACCTC
ACGCTCTACCGCATCGGCGAAGAGACGATGGCGCCCACGTCCGCGCTCCCCATCGGCGCGACGCGCGTCGTGTCC
GAGATGCAGCCGCTCCTCGTGGACCCCGCGCAGCCGGGCTCGGGCCTCTACAACGCGGTCCTGGCGCTGCTCGCG
CCGCCGAACCCGGACGAGTCGGAGCGCTACGACGAAGAGATGCTCGACCTCCCCGTCGTCGGGTTTCTGGTGATC
ACGACGCTGGACATTCCCAACAAGCGCATGACCGTGCTTGCGCCGACGCAGGGCTCTCTGGTCGGTCGGACCGCC
ATTGTCGGCTCGATCGAGTGGCAAGAATGA
Gene >RhoplFPRL280|117_7
ATGTCGGGACTAGGTCTGCTAAATAGTGATAGCAAGCCCCTTCCAGCCGACGATGAGGCGGCTGCGAATACGCGG
CAATGGGATCTTGCCTCCGAGACTGAGTACAGATTTGAACTCGATCCAAACAGCTCTTTAGCGATCAAGGTGCGT
TTCAGATGCTGCACAACGCAGTACATTTAATTCGTCCGCATGGTCCTTCCACGACAATACCGAATCAACCATTTC
TTTCCAGCTCGTACATGGTCAAGCAGAAATTTTTGGTGCCGAACTTGCCGAGGGCAACACCTATGTATTCGGCCT
CGAATGCAAGGCAGCCGTGTATACATGGCAAGGTTGCACAATAGAGATGAGTCCCCCTCCATCTCTTGCTATAGA
TCATGAAGAAACTTATCTCTATGCCCTCTTTCCGTGGTCTTATTACGTCACAGGCCAGCCATCCACGGAGTATGT
CTCTGAGGAGACTCCCATGCAGGTTTACGCCAACCTGGTCCTTGCACTCGAACAGATGCGCGTAAGAGCCCTGCG
AGCCTTCCACGGCTCTCCCCCATCTTCAGAGGAAGGACCCGACCCAGACCCGGATCCCCAACCACCACGCGTTCT
CGTTTTAGGACCGGCGAATTCTGGCAAGACCACGCTATCAAAAATGCTCATCAACTATGCCGTCCGTATGGGTCA
GAGCTGGAATCCAGTCCTGGTCAACGTCGATCCCGGTGAGGTATGTCAACGCTCGCATACATACTCTGCGCCATT
TTTCTTACCTTCTGAATCCTCAGGGTGGCTGGGCAGCACCAGGTGCAATCTCTGCCGCAACCATTACGTCACCAA
TACAGACATCTACACCGGCATCAACATTTGGCTCGGCCGCTACATCCGCTCCTGCACATCTCACCTCCAATGCCC
TCCTTCCCTTAGCATATTGGTATGGCCACGCGGAAACTCGGCGCAACCCACTCCTGATGGACCGGCTGATACGTA
ATCTCGGTGAGAATATCTGGGAGCGGTGGGACAATGACCTCGAAGGTGATACCTGAGATTCCCCTCGCAGATCGT
GTCCACGTTCTGATGCTCTCGACGTCTATTCAGGACGTGTTGCGGGACTCATCGTCGACACACCCTCATCATTCG
CGGCAAGCTCGGGTCCCAATGGGGACCATCGACACGCCCTTATCAAAGCCTGCGTGGATGCATTTCGAAGTGAGC
CGGAGTATATCCACGAAGCCAGGCGATACTGAATGGCGTTCTCCCATCCCAGTCAACGTCATTCTCATCGTCGGG
CACGAGAAGCTGAACGTCGAGATGCAGCGAGCATACGGTAACCGCATCGCCGTCGTCAAAATCCCCAAATCGGGC
GGGGTGAGTGCCACACCCGCACACCCCTATCCTATCCCGCAGCTGACTGACCGCCCCGTTCGTCATCTCCCCCCC
CCCTCACATAGGTCGTCGAGCTCGACCCGAGCTACCGCGAGCGCGCGCGCAAGCACCAGCTCCACAACTACATGT
ACGGCAGGATCATCCCGCCCCCGCCGGGCCTCCCGCCCACGAACGTCCTCCAGGGCGGCGAGCAGACGCCCGACC
TCACGCTCAACCTCGCGCCGTCCTCGTCTATCGTCGCCTTCGGCGACCTCACGCTCTACCGCATCGGCGAAGGTG
CGTCGGCCGCGGGCTTCATGTCTTTCTTTTGCTTTTACCCGCTGCGAGCGCCATGCTGATCATGGAATAAATCTT
CACCCCCACGCCCCGCCTTCCCCGGGCCTTCACAGAGACGATGGCGCCCACGTCCGCGCTCCCCATCGGCGCGAC
GCGCGTCGTGTCCGAGATGCAGCCGCTCCTCGTGGACCCCGCGCAGCCGGGCTCGGGCCTCTACAACGCGGTCCT
GGCGCTGCTCGCGCCGCCGAACCCGGACGAGTCGGAGCGCTACGACGAAGAGATGCTCGACCTCCCCGTCGTCGG
GTTTCTGGTGATGTGCGTCCGCTTCGCTTGCTTCGCCGCGTGCTCACGATGTCGGCCGCTGACTCCACTGACTCC
GCTGTGCAGCACGACGCTGGACATTCCCAACAAGCGCATGACCGTGCTTGCGCCGACGCAGGGCTCTCTGGTCGG
TCGGACCGCCATTGTCGGCTCGATCGAGTGGCAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail