Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|117_6
Gene name
LocationNODE_117:38402..40867
Strand-
Gene length (bp)2465
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-29 79 442

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 135 154 19
2 159 181 22
3 194 216 22
4 226 248 22
5 336 358 22
6 362 384 22
7 391 413 22
8 457 479 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|117_6
MSDPEKRPSVSPLDVNLSSSGSSVEKHGEHDVVNAYDVDVAAQLTSGTGVAIDPAESARVRRKIDLHLMPLMCAS
RSMQFADKTTLGQSAVLGLLTGDHLTQNQFNWLGTIFYLFYLGFEFPQNYALQRFPVGKWVSINIFIWAVALLCH
AAAKTFGQLFACRVFLGICEGAITPGFMIVTSMFYTRQEQTQRVGYWFLMNGAAIIMLGLIAYGTLHIQSSVLMP
WQWLMIIFGIITFVVSILFWFFFPDSPATASFLTPEEKVIAIERIKVNQAGVENKHFKMDQRVLRFVECFKDPKT
WLFFFFAAISNVTNSLSNQRQIIVAEFGFTDIQTTLLGCVDGVVEIIVIFCTTTSAAYWPNGRAYSGALAYCVAI
LGSILVNALPSKDRVGLLFCYWISISEIAPFVVMLAWVGSTTAGHTKRVTTNAVVMVGYAVGNAVGPQYWKAEYQ
PRNHIPWAILTACWFVSGVLLLVTRWYLARENAKRDREAHDPTYDDVYITDEATKSEKKVDKAFLDLTDIQNRDF
RYVL*
Coding >RhoplFPRL280|117_6
ATGAGCGACCCCGAGAAGCGTCCATCTGTCAGTCCCCTTGACGTCAATCTCAGTAGCTCTGGCTCGTCCGTCGAG
AAACATGGCGAACACGACGTGGTCAACGCGTACGATGTCGACGTCGCGGCCCAGCTCACCTCAGGAACGGGGGTC
GCCATCGACCCCGCAGAGTCTGCCAGAGTCCGACGGAAGATCGACCTACATTTGATGCCTCTCATGTGTGCGTCC
CGTAGTATGCAGTTCGCCGACAAGACGACATTAGGACAGTCTGCGGTCCTGGGCCTCCTGACCGGAGACCATCTG
ACGCAAAACCAATTCAACTGGCTCGGAACGATCTTCTATCTCTTCTATCTCGGCTTTGAGTTCCCGCAGAATTAC
GCGCTGCAGCGGTTCCCGGTCGGGAAATGGGTCAGTATCAATATATTCATTTGGGCTGTTGCATTGCTCTGTCAT
GCGGCAGCGAAGACCTTTGGCCAGCTGTTTGCCTGCCGGGTCTTCCTCGGCATCTGCGAGGGTGCAATCACCCCC
GGGTTCATGATCGTCACATCCATGTTTTACACTCGCCAAGAACAGACCCAGAGAGTAGGTTATTGGTTCCTGATG
AATGGCGCCGCCATAATCATGCTCGGTCTCATCGCATATGGGACACTACATATTCAATCGAGCGTATTGATGCCA
TGGCAATGGTTGATGATTATCTTCGGTATCATCACTTTTGTGGTCTCCATACTTTTCTGGTTCTTTTTCCCTGAC
TCGCCGGCGACTGCATCGTTCCTGACCCCCGAAGAGAAAGTGATCGCTATCGAGCGTATCAAAGTAAACCAGGCC
GGTGTCGAGAACAAGCACTTTAAGATGGACCAGCGCGTCCTCAGATTCGTCGAGTGCTTCAAGGACCCGAAGACA
TGGCTTTTCTTCTTCTTTGCCGCTATCTCGAACGTCACAAACTCGCTCAGTAACCAGCGACAAATCATCGTCGCA
GAGTTCGGCTTCACCGATATACAGACAACGTTGCTAGGTTGCGTCGACGGTGTCGTTGAGATCATCGTGATCTTC
TGCACGACGACGTCCGCGGCGTATTGGCCAAACGGGCGAGCATACTCCGGGGCGCTTGCGTATTGTGTCGCCATT
CTCGGCTCGATCCTCGTTAATGCGCTTCCGTCCAAGGATCGAGTTGGTCTGCTGTTCTGCTACTGGATATCTATT
TCTGAGATTGCTCCGTTCGTTGTCATGCTGGCATGGGTTGGCTCGACCACGGCCGGGCACACAAAACGCGTGACA
ACCAATGCAGTTGTCATGGTCGGCTACGCAGTTGGCAATGCCGTTGGCCCACAATACTGGAAGGCCGAGTATCAA
CCGCGCAACCACATCCCGTGGGCAATCCTTACCGCGTGCTGGTTCGTCTCCGGCGTGTTGCTGCTCGTCACGCGG
TGGTACCTTGCGCGCGAGAACGCGAAGCGTGACCGAGAGGCTCACGACCCGACGTATGACGACGTCTACATCACC
GACGAGGCGACAAAATCGGAGAAGAAGGTCGACAAGGCTTTCCTCGACCTCACGGATATCCAGAATAGGGATTTC
CGATACGTGCTTTGA
Transcript >RhoplFPRL280|117_6
ATGAGCGACCCCGAGAAGCGTCCATCTGTCAGTCCCCTTGACGTCAATCTCAGTAGCTCTGGCTCGTCCGTCGAG
AAACATGGCGAACACGACGTGGTCAACGCGTACGATGTCGACGTCGCGGCCCAGCTCACCTCAGGAACGGGGGTC
GCCATCGACCCCGCAGAGTCTGCCAGAGTCCGACGGAAGATCGACCTACATTTGATGCCTCTCATGTGTGCGTCC
CGTAGTATGCAGTTCGCCGACAAGACGACATTAGGACAGTCTGCGGTCCTGGGCCTCCTGACCGGAGACCATCTG
ACGCAAAACCAATTCAACTGGCTCGGAACGATCTTCTATCTCTTCTATCTCGGCTTTGAGTTCCCGCAGAATTAC
GCGCTGCAGCGGTTCCCGGTCGGGAAATGGGTCAGTATCAATATATTCATTTGGGCTGTTGCATTGCTCTGTCAT
GCGGCAGCGAAGACCTTTGGCCAGCTGTTTGCCTGCCGGGTCTTCCTCGGCATCTGCGAGGGTGCAATCACCCCC
GGGTTCATGATCGTCACATCCATGTTTTACACTCGCCAAGAACAGACCCAGAGAGTAGGTTATTGGTTCCTGATG
AATGGCGCCGCCATAATCATGCTCGGTCTCATCGCATATGGGACACTACATATTCAATCGAGCGTATTGATGCCA
TGGCAATGGTTGATGATTATCTTCGGTATCATCACTTTTGTGGTCTCCATACTTTTCTGGTTCTTTTTCCCTGAC
TCGCCGGCGACTGCATCGTTCCTGACCCCCGAAGAGAAAGTGATCGCTATCGAGCGTATCAAAGTAAACCAGGCC
GGTGTCGAGAACAAGCACTTTAAGATGGACCAGCGCGTCCTCAGATTCGTCGAGTGCTTCAAGGACCCGAAGACA
TGGCTTTTCTTCTTCTTTGCCGCTATCTCGAACGTCACAAACTCGCTCAGTAACCAGCGACAAATCATCGTCGCA
GAGTTCGGCTTCACCGATATACAGACAACGTTGCTAGGTTGCGTCGACGGTGTCGTTGAGATCATCGTGATCTTC
TGCACGACGACGTCCGCGGCGTATTGGCCAAACGGGCGAGCATACTCCGGGGCGCTTGCGTATTGTGTCGCCATT
CTCGGCTCGATCCTCGTTAATGCGCTTCCGTCCAAGGATCGAGTTGGTCTGCTGTTCTGCTACTGGATATCTATT
TCTGAGATTGCTCCGTTCGTTGTCATGCTGGCATGGGTTGGCTCGACCACGGCCGGGCACACAAAACGCGTGACA
ACCAATGCAGTTGTCATGGTCGGCTACGCAGTTGGCAATGCCGTTGGCCCACAATACTGGAAGGCCGAGTATCAA
CCGCGCAACCACATCCCGTGGGCAATCCTTACCGCGTGCTGGTTCGTCTCCGGCGTGTTGCTGCTCGTCACGCGG
TGGTACCTTGCGCGCGAGAACGCGAAGCGTGACCGAGAGGCTCACGACCCGACGTATGACGACGTCTACATCACC
GACGAGGCGACAAAATCGGAGAAGAAGGTCGACAAGGCTTTCCTCGACCTCACGGATATCCAGAATAGGGATTTC
CGATACGTGCTTTGA
Gene >RhoplFPRL280|117_6
ATGAGCGACCCCGAGAAGCGTCCATCTGTCAGTCCCCTTGACGTCAATCTCAGTAGCTCTGGCTCGTCCGTCGAG
AAACATGGCGAACACGACGTGGTCAACGCGTACGATGTCGACGTCGCGGCCCAGCTCACCTCAGGAACGGGGGTC
GCCATCGACCCCGCAGAGTCTGCCAGAGTCCGACGGAAGATCGACCTACATTTGATGCCTCTCATGTGTGGTGCG
TGTCCGGTCCCCAGCGTTGAGCTCCTCGTGTGGCGCTGACACGTTCTGTTCTGTTCCAGTCATGTATCTGTAAGT
TTGTAATGAATGCGCGCGGAACCGCGGTGTTGAACGTCCCGTAGTATGCAGTTCGCCGACAAGACGACATTAGGA
CAGTCTGCGGTCCTGGGCCTCCTGTGAGCCTCTAACCTATTCCCACATTTCATGTGGCGCCTCTGACACTAGGTT
GCCAACGTGGGCAATAGGACCGGAGACCATCTGACGCAAAACCAATTCAACTGGCTCGGAACGATCTTCTATCTC
TTCTATCTCGGCTTTGAGTTCCCGCAGAATTACGCGCTGCAGCGGTTCCCGGTCGGGAAATGGGTCAGGTACGGC
TCGCTATTCTTAGATTGCCGGCCGGCATGACGAGACTAACTATCTGCTGCGTGCTTCGCATAGTATCAATATATT
CATTTGGGCTGTTGCATTGCTCTGTCATGCGGCAGCGAAGACCTTTGGCCAGCTGTTTGCCTGCCGGGTCTTCCT
CGGCATCTGCGAGGGTGCAATCACCCCCGGGTTCATGATCGTCACATCCATGTTTTACACTCGCCAAGAACAGAC
CCAGAGAGTAGGTTATTGGTGTGAGTGTCATTACACGCGTTCCGAAGTCCGGAGTTTGACACGCACGTTTGACTA
GTCCTGATGAATGGCGCCGCCATAATCATGCTCGGTCTCATCGCATATGGGACACTACATATTCAATCGAGCGTA
TTGATGCCATGGCAATGGTATAGTTTATTTCGTTGCATACTAAGGTAGCGGCTGATCGCCACTTCCACACAGGTT
GATGATTATCTTCGGTATCATCACTTTTGTGGTCTCCATACTTTTCTGGTAAGGGTTCAATTCGACAGCACAATA
ACTCGTTTGTTCCAATGAGCCGAAACTGACGGTTGCTCATGTTCTCCAGGTTCTTTTTCCCTGACTCGCCGGCGA
CTGCATCGTTCCTGACCCCCGAAGAGAAAGTGATCGCTATCGAGCGTATCAAAGTAAACCAGGCCGGTGTCGAGA
ACAAGCACTTTAAGATGGACCAGTCAGTCGACTCTCCTTCATTCTGATCGACTGTAGTTGAAAGGCGCGTCCTCA
GATTCGTCGAGTGCTTCAAGGACCCGAAGACATGGCTTTTCTTCTTCTTTGCCGCTATCTCGTGAGTCTCGGTAT
ATTGTCTCAGCTACCTCCTTATTTCTTACTTTTGCATTTTAGGAACGTCACAAACTCGGTATGCATCCGATTCCC
CAGGCAGTTATCCCGGCAATGTTGCCTGACACGTGCCTTTTACAGCTCAGTAACCAGCGACAAATCATCGTCGCA
GAGTTCGGCTTCACCGATATACAGACAACGTTGCTAGGTTGCGTCGACGGTGTCGTTGAGAGTACGTATAGTACG
GTTATTTATCCAGTTCGGTTGTACTGAAGAGCTTCCTTACAGTCATCGTGATCTTCTGCACGACGACGTCCGCGG
CGTATTGGCCAAACGGGCGAGCATACTCCGGGGCGCTTGCGTATTGTGTCGCCATTCTCGGCTCGATCCTCGTTA
ATGCGCTTCCGTCCAAGGATCGAGTTGGTCTGCTGTTCTGCTACTGGATATCTAGTATGTGCTAGTCCTGCAACC
TTATGTACATTCACTAACAACTGGGTTTCCAGTTTCTGAGATTGCTCCGTTCGTTGTCATGCTGGCATGGGTTGG
CTCGACCACGGCCGGGCACACAAAACGTGGGCATCGATGCACTGACCTACTCTGTGTGCAGTGTTGACTCTTGTT
ATGTAGGCGTGACAACCAATGCAGTTGTCATGGTCGGCTACGCAGTTGGCAATGCCGTTGGCCCACAATACTGGA
AGGCCGAGTATCAACCGCGGTACATCTCTATCTTCGACAGACTATTCTAGCCTGCTGACAGGCTTTGTTCGATAG
CAACCACATCCCGTGGGCAATCCTTACCGCGTGCTGGTTCGTCTCCGGCGTGTTGCTGCTCGTCACGCGGTGGTA
CCTTGCGCGCGAGAACGCGAAGCGTGACCGAGAGGCTCACGACCCGACGTATGACGACGTCTACATCACCGACGA
GGCGACAAAATCGGAGAAGAAGGTCGACAAGGTATGTAGTCCGCGCATCAAATCCACCACCGCGCCTGATGTTAA
TTTTCCAACAGGCTTTCCTCGACCTCACGGATATCCAGAATAGGGATTTCCGATACGTGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail