Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|117_4
Gene name
LocationNODE_117:59188..62187
Strand-
Gene length (bp)2999
Transcript length (bp)1926
Coding sequence length (bp)1926
Protein length (aa) 642

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 9.4E-41 124 441
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 3.1E-05 285 369
PF13499 EF-hand_7 EF-hand domain pair 1.3E-07 456 514
PF13202 EF-hand_5 EF hand 1.8E-04 457 475

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|117_4
MLLRAAARPPPIARLCGPSSLLRTRPFSSALTPPPPRPRFVRVRTFVRWSGYLAGSTVVGVAILTSAIFLHDAFT
YNTQHIDGVPVSPLALHPERGGPKNLPVLRRLLSDYQDEENEGLVDKPHLVIVGGGWGAVAILNTLRPSDYHVTL
VSPDTYTTFTPLLPSAAVGTVQVRSLVEPLRKLLARLRGHLLNASAVDLVMSERLLEVETVRSDGTKERIYVPYD
KLVIAVGSTSSTHGVPGLEHCFQLKTVRDARKIRQRILDNFEAASLPTTTPEERRRLLSFVVCGGGPTGVEAAAE
IYDLCQEDIINYYPKLCREEVSIHVIQSREHILNTYSEAISRYAENKFLHDDIGLITSARVAAVHADHVEYTTRG
PDGQAVRHEIPTNFVLWSTGIAMNPFTERVSNLLPNQVHKKAIEVDAHLRVKGAPVGEVYAIGDASTIETSVVSY
LLELVDEADKNKDGKIDYDEWRVMVNRIKARIPMAESQLQKVRELFDLYDEDSDNTITLNELAVLLQEIGNKITA
LPATAQVASQQGKYLGRKLTKLAKQRDVLIQNGLAFGPGADEAVSGAFKYLHLGSLAYIGNAAVFDLGKTSFMGG
LAAMYAWRSVYWSEQVSSRTRALLMIDWIVRGVWGRDLSRL*
Coding >RhoplFPRL280|117_4
ATGCTCCTCCGCGCGGCTGCACGACCCCCGCCCATAGCCCGTCTCTGCGGCCCCTCGTCTCTCCTGCGCACACGA
CCCTTCTCCTCCGCCCTCACGCCTCCGCCTCCACGCCCGCGCTTCGTGCGCGTCCGCACCTTCGTCCGCTGGTCC
GGCTACCTCGCAGGCTCCACCGTCGTCGGCGTCGCCATCCTCACCTCTGCCATCTTCCTCCACGATGCCTTTACC
TACAACACCCAGCACATCGACGGCGTCCCCGTCTCGCCCCTCGCCCTCCACCCCGAGCGCGGCGGCCCAAAGAAC
CTCCCCGTCCTCCGTAGACTCCTCAGCGACTATCAGGACGAAGAGAATGAGGGCCTCGTCGACAAACCCCACCTT
GTCATCGTCGGTGGTGGCTGGGGTGCCGTCGCCATCCTAAACACCCTCCGCCCTTCTGACTATCACGTCACCCTT
GTCTCCCCCGACACGTATACCACCTTCACCCCGCTCCTCCCATCCGCCGCCGTCGGCACCGTCCAGGTCCGTTCC
CTTGTCGAGCCGCTCCGCAAGCTTCTCGCACGTCTCCGCGGCCACCTCCTCAACGCCAGCGCCGTCGACCTCGTC
ATGTCTGAGCGCCTTCTCGAAGTCGAGACCGTGCGCTCCGACGGCACCAAGGAGCGCATATACGTCCCGTACGAC
AAGCTGGTCATAGCCGTCGGCTCGACGAGCAGTACACACGGCGTCCCCGGCCTCGAGCACTGCTTCCAGCTCAAG
ACGGTGCGCGACGCGCGGAAGATTCGACAACGGATACTGGACAACTTCGAGGCGGCATCACTGCCGACGACAACG
CCGGAAGAGCGTCGGCGGCTGCTCAGCTTCGTCGTGTGCGGCGGCGGGCCGACGGGTGTTGAGGCCGCCGCGGAG
ATATACGACCTGTGCCAGGAGGATATCATCAACTACTACCCGAAGCTGTGCCGTGAGGAGGTCTCGATACACGTC
ATCCAAAGCCGGGAGCACATCCTCAACACGTACTCGGAGGCCATTTCGCGCTATGCAGAGAACAAGTTCCTGCAC
GACGACATCGGGTTGATCACGTCCGCGCGCGTCGCGGCGGTGCACGCGGACCACGTCGAGTACACGACGCGCGGG
CCGGACGGCCAGGCGGTGCGGCACGAGATCCCGACGAACTTTGTGCTGTGGAGCACGGGCATCGCGATGAACCCG
TTCACGGAGCGCGTGTCCAACTTGCTGCCGAACCAGGTGCATAAGAAGGCGATCGAGGTCGACGCACACCTGCGC
GTAAAGGGCGCGCCGGTGGGCGAGGTGTACGCGATTGGCGACGCCAGCACGATTGAGACGTCGGTCGTGAGCTAC
CTGTTGGAACTCGTCGACGAGGCGGACAAGAACAAGGACGGCAAGATCGACTACGACGAATGGCGCGTTATGGTC
AACCGTATCAAGGCGCGCATCCCGATGGCGGAGTCGCAGCTCCAGAAGGTCCGGGAGCTGTTCGACCTGTACGAC
GAGGACTCGGACAACACCATCACGCTGAACGAGCTCGCGGTGCTCCTGCAGGAGATCGGGAACAAGATCACGGCG
CTGCCCGCGACGGCGCAGGTGGCGTCGCAGCAGGGCAAGTACCTCGGGCGGAAACTCACGAAGCTCGCGAAGCAG
CGCGACGTGCTCATCCAGAACGGACTCGCGTTCGGGCCCGGCGCGGACGAGGCGGTCTCGGGGGCCTTCAAGTAC
CTCCACCTCGGCTCGCTCGCGTACATCGGCAATGCGGCGGTGTTCGACCTCGGCAAGACGAGCTTCATGGGCGGG
CTGGCGGCGATGTACGCGTGGCGCAGCGTGTATTGGAGCGAGCAGGTGAGCTCGCGCACGCGTGCGCTGCTCATG
ATCGACTGGATCGTCCGCGGTGTCTGGGGCAGAGACCTCTCACGGCTGTAG
Transcript >RhoplFPRL280|117_4
ATGCTCCTCCGCGCGGCTGCACGACCCCCGCCCATAGCCCGTCTCTGCGGCCCCTCGTCTCTCCTGCGCACACGA
CCCTTCTCCTCCGCCCTCACGCCTCCGCCTCCACGCCCGCGCTTCGTGCGCGTCCGCACCTTCGTCCGCTGGTCC
GGCTACCTCGCAGGCTCCACCGTCGTCGGCGTCGCCATCCTCACCTCTGCCATCTTCCTCCACGATGCCTTTACC
TACAACACCCAGCACATCGACGGCGTCCCCGTCTCGCCCCTCGCCCTCCACCCCGAGCGCGGCGGCCCAAAGAAC
CTCCCCGTCCTCCGTAGACTCCTCAGCGACTATCAGGACGAAGAGAATGAGGGCCTCGTCGACAAACCCCACCTT
GTCATCGTCGGTGGTGGCTGGGGTGCCGTCGCCATCCTAAACACCCTCCGCCCTTCTGACTATCACGTCACCCTT
GTCTCCCCCGACACGTATACCACCTTCACCCCGCTCCTCCCATCCGCCGCCGTCGGCACCGTCCAGGTCCGTTCC
CTTGTCGAGCCGCTCCGCAAGCTTCTCGCACGTCTCCGCGGCCACCTCCTCAACGCCAGCGCCGTCGACCTCGTC
ATGTCTGAGCGCCTTCTCGAAGTCGAGACCGTGCGCTCCGACGGCACCAAGGAGCGCATATACGTCCCGTACGAC
AAGCTGGTCATAGCCGTCGGCTCGACGAGCAGTACACACGGCGTCCCCGGCCTCGAGCACTGCTTCCAGCTCAAG
ACGGTGCGCGACGCGCGGAAGATTCGACAACGGATACTGGACAACTTCGAGGCGGCATCACTGCCGACGACAACG
CCGGAAGAGCGTCGGCGGCTGCTCAGCTTCGTCGTGTGCGGCGGCGGGCCGACGGGTGTTGAGGCCGCCGCGGAG
ATATACGACCTGTGCCAGGAGGATATCATCAACTACTACCCGAAGCTGTGCCGTGAGGAGGTCTCGATACACGTC
ATCCAAAGCCGGGAGCACATCCTCAACACGTACTCGGAGGCCATTTCGCGCTATGCAGAGAACAAGTTCCTGCAC
GACGACATCGGGTTGATCACGTCCGCGCGCGTCGCGGCGGTGCACGCGGACCACGTCGAGTACACGACGCGCGGG
CCGGACGGCCAGGCGGTGCGGCACGAGATCCCGACGAACTTTGTGCTGTGGAGCACGGGCATCGCGATGAACCCG
TTCACGGAGCGCGTGTCCAACTTGCTGCCGAACCAGGTGCATAAGAAGGCGATCGAGGTCGACGCACACCTGCGC
GTAAAGGGCGCGCCGGTGGGCGAGGTGTACGCGATTGGCGACGCCAGCACGATTGAGACGTCGGTCGTGAGCTAC
CTGTTGGAACTCGTCGACGAGGCGGACAAGAACAAGGACGGCAAGATCGACTACGACGAATGGCGCGTTATGGTC
AACCGTATCAAGGCGCGCATCCCGATGGCGGAGTCGCAGCTCCAGAAGGTCCGGGAGCTGTTCGACCTGTACGAC
GAGGACTCGGACAACACCATCACGCTGAACGAGCTCGCGGTGCTCCTGCAGGAGATCGGGAACAAGATCACGGCG
CTGCCCGCGACGGCGCAGGTGGCGTCGCAGCAGGGCAAGTACCTCGGGCGGAAACTCACGAAGCTCGCGAAGCAG
CGCGACGTGCTCATCCAGAACGGACTCGCGTTCGGGCCCGGCGCGGACGAGGCGGTCTCGGGGGCCTTCAAGTAC
CTCCACCTCGGCTCGCTCGCGTACATCGGCAATGCGGCGGTGTTCGACCTCGGCAAGACGAGCTTCATGGGCGGG
CTGGCGGCGATGTACGCGTGGCGCAGCGTGTATTGGAGCGAGCAGGTGAGCTCGCGCACGCGTGCGCTGCTCATG
ATCGACTGGATCGTCCGCGGTGTCTGGGGCAGAGACCTCTCACGGCTGTAG
Gene >RhoplFPRL280|117_4
ATGCTCCTCCGCGCGGCTGCACGACCCCCGCCCATAGCCCGTCTCTGCGGCCCCTCGTCTCTCCTGCGCACACGA
CCCTTCTCCTCCGCCCTCACGCCTCCGCCTCCACGCCCGCGCTTCGTGCGCGTCCGCACCTTCGTCCGCTGGTCC
GGCTACCTCGCAGGCTCCACCGTCGTCGGCGTCGCCATCCTCACCTCTGCCATCTTCCTCCACGATGCCTTTACC
TACAACACCCAGGTCTGCGTCCCGTCCCGATGGTGCTAACCCGTCCCCCGCTCACCCTCGCCCAACAGCACATCG
ACGGCGTCCCCGTCTCGCCCCTCGCCCTCCACCCCGAGCGCGGCGGCCCAAAGAACCTCCCCGTCCTCCGTAGAC
TCCTCAGCGACTATCAGGACGAAGAGAATGAGGGCCTCGTCGACAAACCCCACCTTGTCATCGTCGGTGGTGGCT
GGGGTGTGCGTGCACTCCTTCTCCCTTCTCCTCCATCCCACTCACCTCGCCCCATTACAGGCCGTCGCCATCCTA
AACACCCTCCGCCCTTCTGACTATCACGTCACCCTTGTCTCCCCCGACACGTATACCACCTTCACCCCGCTCCTC
CCATGTGCGTCCCTTCCCAGTCCGCGATCCTGCCCCATACTCACGGCCTGCAGCCGCCGCCGTCGGCACCGTCCA
GGTCCGTTCCCTTGTCGAGCCGCTCCGCAAGCTTCTCGCACGTCTCCGCGGCCACCTCCTCAACGCCAGCGCCGT
CGACCTCGTCATGTCTGAGCGCCTTCTCGAAGTCGAGACCGTGCGCTCCGACGGCACCAAGGAGCGCATATACGT
CCCGTGAGTCTACGCACTCCTTATACATACTGAAGAGGGCCATGCGCCCGTGCCGTGCGCGGACAGACCAACTGA
CTGGGGGTATGCCGCCGCAGGTACGACAAGCTGGTCATAGCCGTCGGCTCGACGAGCAGTACACACGGCGTCCCC
GGCCTCGAGCACTGCTTCCAGCTCAAGACGGTGCGCGACGCGCGGAAGATTCGACAACGGATACTGGGTGCGTCT
CGCTGCGTGCCCTCGTGATGTCCTCCCTCCCGCGATGTCTGTTCGCTCACCACCCACATGTGCTGCAGACAACTT
CGAGGCGGCATCACTGCCGACGACAACGCCGGAAGAGCGTCGGCGGCTGCTCAGCTTCGTCGTGTGCGGCGGCGG
GCCGACGGGTGTTGAGGCCGCCGCGGAGATATACGACCTGTGCCAGGAGGATATCATCAACTACGTGCGTGCCGG
CTGTGTCTCTGTGCGGCGGCGTGCTCACGTCTCGCGCGACTAATGTGTTATATGCTTTGCACGGACAGTACCCGA
AGCTGTGCCGTGAGGAGGTCTCGATACACGTCATCCAAAGCCGGGAGCACATCCTCAACACGGTAGGCGCGATGA
TTTTCTGGAGCCCGGGGGCGTGCGCTGAGCGCAGACCCTCCACAGTACTCGGAGGCCATTTCGCGCTATGCAGAG
GTAACACGACCGTCATCGTTCCCTATTTTCTTTTTGCTCTTTACTGATTTCCCGTTGATGGCGCACAGAACAAGT
TCCTGCACGACGACATCGGGTTGATCACGTCCGCGCGCGTCGCGGCGGTGCACGCGGACCACGTCGAGTACACGA
CGCGCGGGCCGGACGGCCAGGCGGTGCGGCACGAGATCCCGACGAACTTTGTGCTGTGGAGCACGGGCATCGCGA
TGAACCCGTTCACGGAGCGCGTGTCCAACTTGCTGTGAGTGTCCGTGTTCGTGTGCTTTGGGCGTTGATGTGCTG
CTCTTTGCTCTTCGCGAGTCCTTGGGGGGGATGTGCGAGGGGGGCTTGGTGAATGAGAATGCTGATGCTGCCGGA
CGTTTTTAGGCCGAACCAGGTGCATAAGAAGGCGATCGAGGTCGACGCACACCTGCGCGTAAAGGGCGCGCCGGT
GGGCGAGGTGTACGCGATTGGCGACGCCAGCACGGTGTGTGACCTTGCTCCTCATGAACAACACTGGCTCACGGC
CGTCCTTTGCCCTGTGCGCAGATTGAGACGTCGGTCGTGAGCTACCTGTTGGAACTCGTCGACGAGGCGGACAAG
AACAAGGACGGCAAGATCGACTACGACGAATGGCGCGTTATGGGTGCGTGTGCAGTGGTGCCGTTGGGACACACG
GTGCGCGGAGGGAGCCCGTCGTTGACGCCGTGAACAGTCAACCGTATCAAGGCGCGCATCCCGATGGCGGAGTCG
CAGCTCCAGAAGGTGCGCCCCGGGGATTGTCCTGTGAATACGTGGTCAGAGGCTGAGGCTGATGATATTGCACGG
TGCACGGCGCGCAGGTCCGGGAGCTGTTCGACCTGTACGACGAGGACTCGGACAACACCATCACGCTGAACGAGC
TCGCGGTGCTCCTGCAGGAGATCGGGAACAAGATCACGGCGCTGCCCGCGGTGCGCGTTTAGTCTCTCTTGTGTG
CGCGTGTGCGCGGATCTTGTCTCATGTGGGTGTCGCTTTGCAGACGGCGCAGGTGGCGTCGCAGCAGGGCAAGTA
CCTCGGGCGGAAACTCACGAAGCTCGCGAAGCAGCGCGACGTGCTCATCCAGAACGGACTCGCGTTCGGGCCCGG
CGCGGACGAGGCGGTCTCGGGGGCCTTCAAGTACCTCCACCTCGGCTCGCTCGCGTACGCATGCATGATCGCTTC
CTCTCACCTGGTGCTGATGTGTGTTGTGTGTTCGGCACCGCGTCTGGTTTTCAGGTACATCGGCAATGCGGCGGT
GTTCGACCTCGGCAAGACGAGCTTCATGGGCGGGCTGGCGGCGATGTACGCGTGGCGCAGCGTGTATTGGAGCGA
GCAGGTGAGCTCGCGCACGCGTGCGCTGCTCATGATCGACTGGATCGTCCGGTGCGTGGTCGCGAATTCCCTGTT
TGTTTCTGCCGGTTCTTACCCATGTTGGCTGGCATCACAGCGGTGTCTGGGGCAGAGACCTCTCACGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail