Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|117_14
Gene name
LocationNODE_117:53340..54698
Strand+
Gene length (bp)1358
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 3.7E-70 53 355
PF14543 TAXi_N Xylanase inhibitor N-terminal 8.3E-09 55 202

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|117_14
MKGTSTSSVDIVLPVPTSPISTSQTSSPITEPTQPTSLQSEPLIDNDSGLLWTGSIEIGTPPQSFIVCFDTGSAD
LWVASSQCNGCDAQDTYDASSSSTSQEQQGTFQISYEGGQDVTGPIYTDTVVSVAGVNVTGQYFSPVTQASDMSN
EFPLDGILGMGWPQLSNLQQDPYFFSAISQNAVQQGVFGFYLAANNSELYLGGTDSTLYTGSIEYHALASDSEGW
WQIANASFLVNGQSAASGFETIIDSGSTFMSAPVEAAAQVYGTIEGAQQTEEGFYMFPCSSAPTVAFSWGGNNWE
IPADSFNLGEVEEDYCLGALISADMGTNAWTVGDVFLTNVYSAFSVDQGAVGFATLA*
Coding >RhoplFPRL280|117_14
ATGAAGGGGACTTCCACTAGTAGTGTCGACATCGTACTCCCAGTCCCCACATCCCCAATCTCCACATCCCAAACC
AGTAGCCCGATAACGGAGCCCACCCAGCCCACAAGCCTCCAGTCGGAGCCGCTCATTGACAATGACAGCGGGCTG
CTGTGGACAGGCTCAATTGAGATTGGGACACCTCCGCAGAGTTTCATTGTTTGCTTCGACACAGGCTCGGCCGAC
CTGTGGGTTGCGTCGTCTCAGTGCAACGGGTGCGATGCTCAAGACACTTACGATGCGTCGTCCTCGTCGACAAGC
CAGGAACAGCAAGGCACTTTCCAAATTTCATATGAAGGTGGCCAGGATGTCACCGGGCCGATCTATACGGACACT
GTAGTGAGCGTCGCAGGCGTGAATGTCACTGGGCAGTATTTCAGCCCTGTAACGCAAGCATCAGACATGAGCAAT
GAATTCCCGCTGGATGGCATCTTGGGCATGGGGTGGCCTCAGTTATCCAATCTCCAGCAGGACCCATATTTCTTC
AGCGCAATCTCGCAGAATGCTGTGCAGCAAGGCGTATTTGGGTTCTACCTCGCGGCGAACAACTCAGAACTGTAC
CTTGGTGGAACGGACTCCACGCTTTACACGGGCTCGATCGAGTATCATGCTCTCGCCTCTGATTCTGAAGGCTGG
TGGCAGATTGCCAACGCGAGTTTCCTTGTGAACGGACAGTCAGCCGCATCCGGCTTTGAGACCATCATTGATTCT
GGCTCTACATTTATGTCCGCCCCGGTGGAAGCCGCCGCACAGGTGTACGGGACCATCGAGGGCGCGCAGCAAACT
GAGGAAGGATTTTACATGTTCCCGTGTAGTTCGGCTCCCACGGTCGCTTTCAGCTGGGGTGGCAATAACTGGGAG
ATCCCTGCGGACAGCTTCAACTTGGGCGAGGTCGAAGAAGACTATTGTTTGGGCGCGCTCATATCTGCTGATATG
GGTACCAATGCGTGGACGGTCGGTGATGTATTCTTAACGAACGTCTACAGCGCGTTTTCGGTAGACCAGGGTGCC
GTGGGCTTCGCTACCCTGGCTTGA
Transcript >RhoplFPRL280|117_14
ATGAAGGGGACTTCCACTAGTAGTGTCGACATCGTACTCCCAGTCCCCACATCCCCAATCTCCACATCCCAAACC
AGTAGCCCGATAACGGAGCCCACCCAGCCCACAAGCCTCCAGTCGGAGCCGCTCATTGACAATGACAGCGGGCTG
CTGTGGACAGGCTCAATTGAGATTGGGACACCTCCGCAGAGTTTCATTGTTTGCTTCGACACAGGCTCGGCCGAC
CTGTGGGTTGCGTCGTCTCAGTGCAACGGGTGCGATGCTCAAGACACTTACGATGCGTCGTCCTCGTCGACAAGC
CAGGAACAGCAAGGCACTTTCCAAATTTCATATGAAGGTGGCCAGGATGTCACCGGGCCGATCTATACGGACACT
GTAGTGAGCGTCGCAGGCGTGAATGTCACTGGGCAGTATTTCAGCCCTGTAACGCAAGCATCAGACATGAGCAAT
GAATTCCCGCTGGATGGCATCTTGGGCATGGGGTGGCCTCAGTTATCCAATCTCCAGCAGGACCCATATTTCTTC
AGCGCAATCTCGCAGAATGCTGTGCAGCAAGGCGTATTTGGGTTCTACCTCGCGGCGAACAACTCAGAACTGTAC
CTTGGTGGAACGGACTCCACGCTTTACACGGGCTCGATCGAGTATCATGCTCTCGCCTCTGATTCTGAAGGCTGG
TGGCAGATTGCCAACGCGAGTTTCCTTGTGAACGGACAGTCAGCCGCATCCGGCTTTGAGACCATCATTGATTCT
GGCTCTACATTTATGTCCGCCCCGGTGGAAGCCGCCGCACAGGTGTACGGGACCATCGAGGGCGCGCAGCAAACT
GAGGAAGGATTTTACATGTTCCCGTGTAGTTCGGCTCCCACGGTCGCTTTCAGCTGGGGTGGCAATAACTGGGAG
ATCCCTGCGGACAGCTTCAACTTGGGCGAGGTCGAAGAAGACTATTGTTTGGGCGCGCTCATATCTGCTGATATG
GGTACCAATGCGTGGACGGTCGGTGATGTATTCTTAACGAACGTCTACAGCGCGTTTTCGGTAGACCAGGGTGCC
GTGGGCTTCGCTACCCTGGCTTGA
Gene >RhoplFPRL280|117_14
ATGAAGGGGACTTCCACTAGTAGTGTCGACATCGTACTCCCAGTCCCCACATCCCCAATCTCCACATCCCAAACC
AGTAGCCCGATAACGGAGCCCACCCAGCCCACAAGCCTCCAGTCGGAGCCGCTCATTGACAATGACAGCGGGCTG
CTGTGGACAGGCTCAATTGAGATTGGGACACCTCCGCAGAGTTTCATTGTTTGCTTCGACACAGGCTCGGCCGAC
CTGTGGGTTGCGTCGTCTCAGTGCAACGGGTGCGATGCTCAAGACACTTACGATGCGTCGTCCTCGTCGACAAGC
CAGGAACAGCAAGGCACTTTCCAAATTTCATATGAAGGTGGCCAGGATGTCACCGGGCCGATCTATACGGACACT
GGTGCGTCGACTGCTGCGAGTGTCAAGTTCTACCGCTGATGTGCGTGGGTAGTGAGCGTCGCAGGCGTGAATGTC
ACTGGGCAGTATTTCAGCCCTGTAACGCAAGCATCAGACATGAGCAATGAATTCCCGCTGGATGGCATCTTGGGC
ATGGGGTGGCCTCAGTTATCCAATCTCCAGCAGGTACAAGGCCACCAATCACTCTCGTTGTAGATGCTCACATGG
TCCCACCGCAGGACCCATATTTCTTCAGCGCAATCTCGCAGAATGCTGTGCAGCAAGGCGTATTTGGGTTCTACC
TCGCGGCGAACAACTCAGAACTGTACCTTGGTGGAACGGACTCCACGCTTTACACGGGCTCGATCGAGTATCATG
CTCTCGCCTCTGATTCTGAAGGCTGGTGGCAGATTGCCAACGCGAGTTTCCTTGTGAACGGACAGTCAGCCGCAT
CCGGCTTTGAGACCGTATGTGACATCCTTTGACTGTGCAAAGCGCACTCGAGCACTGAACACATGTTGTCTACCT
GGGATATAGATCATTGATTCTGGCTCTACATTTATGTCCGCCCCGGTGGAAGCCGCCGCACAGGTGTACGGGACC
ATCGAGGGCGCGCAGCAAACTGAGGAAGGATTTTACATGTTCCCGTGTAGTTCGGCTCCCACGGTCGCTTTCAGC
TGGGGTGGCAATAACTGGGAGATCCCTGCGGACAGGTGAGCATATCCAATGTTCATGAATCTTGATGTGGTGCTC
ATGCGAATAGCTTCAACTTGGGCGAGGTCGAAGAAGACTATTGTTTGGGCGCGCTCATATCTGCTGATATGGGTA
CCAATGCGTGGACGGTCGGTGATGTGTGAGTAGGATTCTCTGCGCCGTCCAAACATTGAACCTGACATTGTGCAT
CGCTCTCGCTCAGATTCTTAACGAACGTCTACAGCGCGTTTTCGGTAGACCAGGGTGCCGTGGGCTTCGCTACCC
TGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail