Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|117_12
Gene name
LocationNODE_117:46906..48419
Strand+
Gene length (bp)1513
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain 1.6E-66 250 387
PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain 2.2E-47 128 248
PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain 8.6E-44 17 114

GO

GO Term Description Terminal node
GO:0006556 S-adenosylmethionine biosynthetic process Yes
GO:0004478 methionine adenosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:1901576 organic substance biosynthetic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0006790 sulfur compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0009987 cellular process No
GO:0044272 sulfur compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0046500 S-adenosylmethionine metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|117_12
MPANGTARASALAPGHFLFTSESVGEGHPDKICDQVSDAILDACLAQDPFSKVACETASKTGMIMVFGEITTKGQ
IDYQKVIRETIKQIGYDDSSKGFDYKTCNILVAIEQQSPDIAQGLDHGALEHIGAGDQGIMFGYATDETPEYMPL
TLVLAHRLNEAMAVARRAGVLPWLRPDSKTQVTVEYKKDGGATIPLRVDTVVVSTQHAEEISTEELRKEILEKIV
KQVIPANLLDERTVYHIQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDWSKVDRSAAYTARWIA
KSLIAGGLARRALVQLSYAIGVAEPLSIYVDTYGTGKKSDEDLVDVIRNNFDLRPGVIVQQLGLQKPQYRKTASY
GHFGNPEYSWEQPKKLQL*
Coding >RhoplFPRL280|117_12
ATGCCCGCTAACGGTACTGCTCGCGCTTCCGCCCTCGCGCCAGGTCATTTCCTCTTTACTTCCGAGTCTGTCGGC
GAGGGTCATCCCGATAAGATTTGCGACCAGGTCTCTGATGCTATCCTCGATGCCTGTCTGGCACAGGACCCCTTC
TCGAAGGTCGCTTGCGAGACTGCCTCCAAAACCGGCATGATCATGGTCTTCGGTGAAATTACCACGAAGGGGCAG
ATCGACTACCAGAAGGTTATCCGTGAAACCATCAAGCAAATCGGGTATGACGACTCCTCGAAGGGATTCGACTAC
AAGACCTGTAACATTCTTGTCGCGATCGAGCAGCAGTCGCCGGATATCGCCCAGGGACTTGACCACGGCGCGCTC
GAGCACATCGGTGCCGGTGACCAGGGTATCATGTTCGGCTATGCAACGGACGAGACGCCTGAGTACATGCCTCTC
ACGCTCGTTCTCGCCCACCGCCTGAACGAAGCGATGGCTGTTGCTCGCCGCGCGGGCGTCCTCCCTTGGCTCCGT
CCCGACTCTAAGACTCAAGTCACCGTTGAGTACAAGAAAGATGGCGGTGCTACAATCCCTCTCCGTGTCGACACG
GTTGTCGTGTCCACTCAGCACGCTGAGGAGATCTCCACCGAGGAGCTCCGCAAGGAGATCCTGGAGAAGATCGTC
AAGCAGGTTATTCCCGCAAACCTGCTTGATGAGCGCACCGTTTACCACATTCAACCTTCTGGGCGTTTCGTCATC
GGCGGTCCCCAGGGTGATGCCGGTCTCACTGGCCGTAAGATTATTGTCGACACCTACGGTGGTTGGGGTGCTCAT
GGAGGAGGTGCCTTCTCTGGCAAGGACTGGTCCAAGGTTGACCGGTCCGCTGCGTACACCGCTCGTTGGATTGCT
AAGTCCTTGATCGCGGGTGGCCTTGCTCGCCGCGCTCTTGTCCAGCTCTCCTATGCCATTGGTGTTGCTGAGCCG
TTGTCCATCTACGTCGACACGTACGGTACGGGCAAGAAGTCCGACGAGGACCTCGTCGATGTTATTCGTAACAAC
TTCGACCTCCGACCTGGTGTCATTGTCCAACAGCTTGGTCTCCAAAAGCCGCAGTACCGCAAGACGGCGTCATAC
GGTCACTTTGGTAACCCGGAGTACTCGTGGGAGCAGCCTAAGAAGCTCCAGCTCTAA
Transcript >RhoplFPRL280|117_12
ATGCCCGCTAACGGTACTGCTCGCGCTTCCGCCCTCGCGCCAGGTCATTTCCTCTTTACTTCCGAGTCTGTCGGC
GAGGGTCATCCCGATAAGATTTGCGACCAGGTCTCTGATGCTATCCTCGATGCCTGTCTGGCACAGGACCCCTTC
TCGAAGGTCGCTTGCGAGACTGCCTCCAAAACCGGCATGATCATGGTCTTCGGTGAAATTACCACGAAGGGGCAG
ATCGACTACCAGAAGGTTATCCGTGAAACCATCAAGCAAATCGGGTATGACGACTCCTCGAAGGGATTCGACTAC
AAGACCTGTAACATTCTTGTCGCGATCGAGCAGCAGTCGCCGGATATCGCCCAGGGACTTGACCACGGCGCGCTC
GAGCACATCGGTGCCGGTGACCAGGGTATCATGTTCGGCTATGCAACGGACGAGACGCCTGAGTACATGCCTCTC
ACGCTCGTTCTCGCCCACCGCCTGAACGAAGCGATGGCTGTTGCTCGCCGCGCGGGCGTCCTCCCTTGGCTCCGT
CCCGACTCTAAGACTCAAGTCACCGTTGAGTACAAGAAAGATGGCGGTGCTACAATCCCTCTCCGTGTCGACACG
GTTGTCGTGTCCACTCAGCACGCTGAGGAGATCTCCACCGAGGAGCTCCGCAAGGAGATCCTGGAGAAGATCGTC
AAGCAGGTTATTCCCGCAAACCTGCTTGATGAGCGCACCGTTTACCACATTCAACCTTCTGGGCGTTTCGTCATC
GGCGGTCCCCAGGGTGATGCCGGTCTCACTGGCCGTAAGATTATTGTCGACACCTACGGTGGTTGGGGTGCTCAT
GGAGGAGGTGCCTTCTCTGGCAAGGACTGGTCCAAGGTTGACCGGTCCGCTGCGTACACCGCTCGTTGGATTGCT
AAGTCCTTGATCGCGGGTGGCCTTGCTCGCCGCGCTCTTGTCCAGCTCTCCTATGCCATTGGTGTTGCTGAGCCG
TTGTCCATCTACGTCGACACGTACGGTACGGGCAAGAAGTCCGACGAGGACCTCGTCGATGTTATTCGTAACAAC
TTCGACCTCCGACCTGGTGTCATTGTCCAACAGCTTGGTCTCCAAAAGCCGCAGTACCGCAAGACGGCGTCATAC
GGTCACTTTGGTAACCCGGAGTACTCGTGGGAGCAGCCTAAGAAGCTCCAGCTCTAA
Gene >RhoplFPRL280|117_12
ATGCCCGCTAACGGTACTGCTCGCGCTTCCGCCCTCGCGCCAGGTCATTTCCTCTTTACTTCCGAGTCTGTCGGC
GAGGGTCATCCCGGTACGTCCACGGCCAGCGTGAAGTTATGAGACGTGATTATTGAACGGTAGTGCAGATAAGAT
TTGCGACCAGGTCTCTGATGCTATCGTCAGTATTGTACTCAGTCACTACATAGAGTGGACCTAATGAGGAAGTGC
ACAGCTCGATGCCTGTCTGGCACAGGACCCCTTCTCGAAGGTCGCTTGCGAGACTGCCTCCAAAACCGGCATGAT
CATGGTCTTCGGTGAAATTACCACGAAGGGGCAGATCGACTACCAGAAGGTTATCCGTGAAACCATCAAGCAAAT
CGGGTATGACGACTCCTCGAAGGGATTCGACTACAAGACCTGTAACATTCTTGTCGCGATCGAGCAGCAGTCGCC
GGATATCGCCCAGGGACTTGACCACGGCGCGCTCGAGCACATCGGTGCCGGTGACCAGGGTATCATGTTCGGCTA
TGCAACGGACGAGACGCCTGAGTACATGCCTCTCACGCTCGTTCTCGCCCACCGCCTGAACGAAGCGATGGCTGT
TGCTCGCCGCGCGGGCGTCCTCCCTTGGCTCCGTCCCGACTCTAAGACTCAAGTCACCGTTGAGTACAAGAAAGA
TGGCGGTGCTACAATCCCTCTCCGTGTCGACACGGTTGTCGTGTCCACTCAGCACGCTGAGGAGATCTCCACCGA
GGAGCTCCGCAAGGAGATCCTGGAGAAGATCGTCAAGCAGGTTATTCCCGCAAACCTGCTTGATGAGCGCACCGT
TTACCACGTATGTATCGCGTGGAGTGATTATTGTCTCCCGCAAACTTACATTTTCGCGATCAGATTCAACCTTCT
GGGCGTTTCGTCATCGGCGGTCCCCAGGGTGATGCCGGTCTCACTGGCCGTAAGATTATTGTCGACACCTACGGT
GGTTGGGGTGCTCATGGAGGAGGTGCCTTCTCTGGCAAGGACTGGTCCAAGGTTGACCGGTCCGCTGCGTACACC
GCTCGTTGGATTGGTGCGTACTACTTGTTTGACGCCGGCCGCAATATAAGACTGATATCCTTTACAGCTAAGTCC
TTGATCGCGGGTGGCCTTGCTCGCCGCGCTCTTGTCCAGCTCTCCTATGCCATTGGTGTTGCTGAGCCGTTGTCC
ATCTACGTCGACACGTACGGTACGGGCAAGAAGTCCGACGAGGACCTCGTCGATGTTATTCGTAACAACTTCGAC
CTCCGACCTGGTGTCATTGGTTCGTAGTATCCTCGATGTCACGGCTGGCAGCGGGTTGCTTATTAGTTCCTTTGC
CCACAGTCCAACAGCTTGGTCTCCAAAAGCCGCAGTACCGCAAGACGGCGTCATACGGTCACTTTGGTAAGTTTG
TCCGATCTGCCTACCTGACATTACACTGATGATTTGCACAGGTAACCCGGAGTACTCGTGGGAGCAGCCTAAGAA
GCTCCAGCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail