Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|117_1
Gene name
LocationNODE_117:29916..33921
Strand+
Gene length (bp)4005
Transcript length (bp)3087
Coding sequence length (bp)3087
Protein length (aa) 1029

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.7E-31 29 297
PF07993 NAD_binding_4 Male sterility protein 1.2E-28 648 887
PF01370 Epimerase NAD dependent epimerase/dehydratase family 8.8E-08 646 847

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 21 43 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|117_1
MYTASKVIKERMRTEGAFDNKTVIALLASSDAIPYAIIEMAVIRANFVVFPLSIRNSPAAVAHLLNKAGVKHILT
SKEQSIADLVRDALDILKTQYIPVTIPGVSSAFTFEELFLSPSNGLAASEELPHDSRDPDAPTMIMHSSGSTAFP
KPIVWSNRRLIEIATYPWYFEREITDLVSSLHSLPFFHGLAFVNVLWAASAGQTLAVFEPRQPPLVPTPDLVFRA
LQASNCDLVWAVPSFIETWAHNEEYIEWLASHEGLTFGGGPLNKEIGDMLISKGVHIYDAYGCTETGMLNVVYEA
EPPIEWDYFRIQKHISIKMLPMGDNTYELVVVANNLHRPAVVNTQVDGVDGYATSDLVVPHPTRPGYWKIVGRTD
DQIMHSTGEKASLALTNPGPLEEILRKDPYVSDCIIFGRGRFQAGVLVQPRSEIRLDLSDDARVASFRNKIWPSV
EKMNAFAPQHSRIFKEMILIAKPSKPFSYTHKGTVRRAPAIKDYEEEINALYDAVDSSSQSAMEPPAHWDDKSAA
SFIRTVVEKLVAVLLKDEDDIFQHGCDSLQATWIRNTILRVLRNSAKIDTRQVNSNFVYDYPTISRMASFVLALA
LGTTDGEDRQPASRADAMRAMVAKYSKDFPIHRGSAAANMESGKVVLITGTTGGLGCYALKELVADPKVARVYAF
NRPAKHGQNLYERQKSALVDRGLDASIVDFEKVVLLEGDLSTTHFDLEEKVFEELHTSVTYIIHNAWRVDFSISL
ASFESNVYGVRALIGFTLTSPLAKPPRLIYTSSIGVFTNIDRDDNLVEASINPDVAIGSGYTESKWVSEEILHNA
AASTPLNPVVVRVGQICGALEGSWNAHEWFPSIVQSAVKLGCFPDDERGVAWVPLDVAAQAIVDFMDTPLHIKVV
HLNHPRPVPWHSLGVHVAQAFSVPLVPYHEWLAKLEQAAQDVSQAEREGSPTRKALQNLHGIQLLPFYRGLAAKF
NVGRLSVGMFQLDVSQAVAASPTLSAPSVSQLGAEHVKNWLAYWRKVGLLAEQ*
Coding >RhoplFPRL280|117_1
ATGTACACGGCGTCCAAGGTGATCAAGGAGCGTATGCGCACCGAAGGAGCCTTCGACAACAAGACGGTTATCGCT
CTACTTGCATCTTCAGATGCCATTCCGTACGCAATCATTGAAATGGCAGTCATTCGTGCCAACTTCGTCGTCTTT
CCCCTCTCCATCCGGAACTCACCTGCCGCTGTGGCGCACTTGTTAAACAAGGCCGGAGTGAAGCACATACTCACT
AGTAAGGAGCAGAGCATCGCCGACCTTGTTCGGGATGCTCTCGATATCTTGAAAACACAATACATCCCCGTGACT
ATTCCTGGCGTCTCTTCCGCATTTACATTCGAGGAGTTGTTCTTGTCCCCTTCTAATGGCCTAGCTGCAAGCGAA
GAGCTGCCACATGATAGCAGGGATCCTGACGCCCCAACAATGATTATGCATTCGTCTGGATCAACGGCGTTCCCA
AAGCCTATAGTATGGTCCAATCGCCGTCTGATAGAAATCGCCACCTACCCGTGGTACTTCGAGCGAGAAATTACA
GATCTCGTTAGTTCTCTGCATTCTTTGCCTTTCTTTCACGGCCTCGCATTTGTGAATGTACTGTGGGCGGCATCT
GCGGGCCAAACACTTGCTGTTTTTGAGCCTAGGCAACCGCCTCTTGTGCCCACACCAGACCTTGTATTCCGTGCC
CTGCAAGCGTCGAATTGCGACCTTGTGTGGGCTGTGCCGTCATTTATTGAGACGTGGGCGCATAATGAAGAATAC
ATCGAGTGGCTCGCCTCCCACGAGGGCTTGACGTTTGGCGGCGGCCCTCTCAACAAGGAGATCGGCGATATGCTA
ATCTCAAAAGGCGTACACATATATGATGCCTACGGATGCACCGAAACGGGAATGTTGAACGTGGTCTACGAAGCC
GAACCCCCCATCGAATGGGACTACTTCAGGATTCAGAAGCATATTTCGATTAAAATGCTTCCTATGGGCGATAAT
ACCTATGAACTTGTTGTCGTTGCGAATAACTTGCACAGACCCGCTGTCGTTAACACACAAGTCGATGGGGTTGAC
GGCTACGCCACATCGGATCTCGTTGTGCCGCATCCGACGAGGCCCGGCTACTGGAAGATCGTGGGTCGTACTGAT
GACCAGATCATGCATAGCACAGGGGAGAAGGCCAGTCTCGCTCTGACAAACCCAGGGCCCCTAGAGGAGATATTA
AGGAAGGATCCCTATGTGTCCGATTGTATCATTTTCGGTCGCGGGCGGTTTCAAGCTGGCGTACTAGTTCAGCCA
AGGTCCGAAATCAGGCTCGACCTTTCTGACGACGCTCGTGTGGCTAGTTTCAGAAACAAAATATGGCCGTCTGTG
GAGAAGATGAACGCTTTTGCACCCCAACATTCTAGGATTTTCAAGGAAATGATCCTGATAGCCAAACCCTCGAAG
CCATTCAGCTACACACACAAGGGCACTGTCCGTCGTGCTCCCGCCATAAAGGACTATGAGGAAGAAATCAATGCT
TTGTACGACGCTGTAGACAGCAGCTCCCAATCGGCCATGGAGCCGCCTGCCCACTGGGACGATAAATCGGCCGCC
TCATTCATACGTACAGTTGTGGAGAAGCTCGTCGCTGTTCTATTGAAAGACGAAGACGATATTTTCCAACACGGT
TGTGACAGTCTGCAAGCAACCTGGATTCGCAACACCATCCTCCGCGTACTTCGTAACTCTGCGAAGATCGATACC
CGCCAGGTCAATTCCAATTTTGTTTACGACTACCCGACTATCTCGCGCATGGCATCATTTGTCTTGGCTCTTGCC
CTCGGTACTACGGACGGAGAGGACCGGCAGCCAGCGTCGCGCGCTGATGCAATGCGGGCCATGGTGGCTAAATAC
AGCAAGGACTTCCCCATACACCGTGGTAGTGCGGCTGCCAACATGGAATCGGGCAAGGTCGTTTTGATCACTGGC
ACGACCGGAGGCCTTGGATGTTATGCGCTCAAGGAGCTCGTCGCGGACCCCAAGGTCGCTCGAGTTTACGCGTTC
AACCGACCGGCAAAGCATGGTCAAAATCTGTACGAAAGGCAAAAGTCTGCGTTGGTTGACCGTGGACTGGATGCT
AGCATTGTTGATTTTGAGAAAGTGGTACTGCTTGAGGGCGACTTGTCTACAACGCATTTCGACTTGGAAGAGAAA
GTCTTCGAGGAGTTGCATACATCGGTCACGTATATCATCCACAACGCATGGCGTGTGGATTTCAGCATTTCATTG
GCATCATTCGAGTCGAACGTGTACGGCGTGCGTGCGCTTATAGGTTTCACCCTCACGTCGCCGCTGGCGAAACCC
CCAAGGCTAATCTACACCAGCTCAATTGGTGTCTTCACGAATATCGACCGTGATGATAATTTAGTCGAGGCTTCG
ATCAACCCCGACGTCGCCATTGGCAGTGGCTACACGGAGTCAAAATGGGTGTCCGAAGAGATCTTACACAATGCC
GCTGCCAGCACGCCGCTCAATCCTGTGGTCGTTCGAGTTGGACAGATCTGTGGTGCTCTGGAAGGCTCGTGGAAC
GCTCACGAATGGTTTCCGTCCATAGTTCAGAGTGCTGTAAAACTGGGATGTTTCCCCGATGATGAGAGGGGTGTT
GCGTGGGTGCCACTCGACGTTGCCGCGCAAGCCATAGTCGACTTCATGGACACGCCGCTGCATATCAAAGTCGTC
CACCTCAATCACCCGCGGCCTGTTCCGTGGCACTCGCTTGGTGTGCACGTCGCACAGGCTTTCTCAGTGCCTCTT
GTCCCGTACCACGAGTGGCTCGCCAAGCTCGAGCAGGCCGCGCAGGACGTCTCCCAAGCCGAGAGGGAGGGCAGC
CCGACGCGTAAAGCCTTGCAGAACCTACACGGGATCCAGCTGCTCCCGTTCTACCGAGGACTCGCTGCTAAGTTT
AATGTCGGTCGGCTGTCTGTAGGAATGTTCCAGCTCGATGTCTCCCAAGCTGTCGCAGCATCCCCGACGTTGTCA
GCCCCTAGTGTATCTCAACTTGGTGCAGAGCACGTCAAGAACTGGTTGGCATATTGGCGAAAGGTTGGGCTGTTG
GCGGAGCAGTGA
Transcript >RhoplFPRL280|117_1
ATGTACACGGCGTCCAAGGTGATCAAGGAGCGTATGCGCACCGAAGGAGCCTTCGACAACAAGACGGTTATCGCT
CTACTTGCATCTTCAGATGCCATTCCGTACGCAATCATTGAAATGGCAGTCATTCGTGCCAACTTCGTCGTCTTT
CCCCTCTCCATCCGGAACTCACCTGCCGCTGTGGCGCACTTGTTAAACAAGGCCGGAGTGAAGCACATACTCACT
AGTAAGGAGCAGAGCATCGCCGACCTTGTTCGGGATGCTCTCGATATCTTGAAAACACAATACATCCCCGTGACT
ATTCCTGGCGTCTCTTCCGCATTTACATTCGAGGAGTTGTTCTTGTCCCCTTCTAATGGCCTAGCTGCAAGCGAA
GAGCTGCCACATGATAGCAGGGATCCTGACGCCCCAACAATGATTATGCATTCGTCTGGATCAACGGCGTTCCCA
AAGCCTATAGTATGGTCCAATCGCCGTCTGATAGAAATCGCCACCTACCCGTGGTACTTCGAGCGAGAAATTACA
GATCTCGTTAGTTCTCTGCATTCTTTGCCTTTCTTTCACGGCCTCGCATTTGTGAATGTACTGTGGGCGGCATCT
GCGGGCCAAACACTTGCTGTTTTTGAGCCTAGGCAACCGCCTCTTGTGCCCACACCAGACCTTGTATTCCGTGCC
CTGCAAGCGTCGAATTGCGACCTTGTGTGGGCTGTGCCGTCATTTATTGAGACGTGGGCGCATAATGAAGAATAC
ATCGAGTGGCTCGCCTCCCACGAGGGCTTGACGTTTGGCGGCGGCCCTCTCAACAAGGAGATCGGCGATATGCTA
ATCTCAAAAGGCGTACACATATATGATGCCTACGGATGCACCGAAACGGGAATGTTGAACGTGGTCTACGAAGCC
GAACCCCCCATCGAATGGGACTACTTCAGGATTCAGAAGCATATTTCGATTAAAATGCTTCCTATGGGCGATAAT
ACCTATGAACTTGTTGTCGTTGCGAATAACTTGCACAGACCCGCTGTCGTTAACACACAAGTCGATGGGGTTGAC
GGCTACGCCACATCGGATCTCGTTGTGCCGCATCCGACGAGGCCCGGCTACTGGAAGATCGTGGGTCGTACTGAT
GACCAGATCATGCATAGCACAGGGGAGAAGGCCAGTCTCGCTCTGACAAACCCAGGGCCCCTAGAGGAGATATTA
AGGAAGGATCCCTATGTGTCCGATTGTATCATTTTCGGTCGCGGGCGGTTTCAAGCTGGCGTACTAGTTCAGCCA
AGGTCCGAAATCAGGCTCGACCTTTCTGACGACGCTCGTGTGGCTAGTTTCAGAAACAAAATATGGCCGTCTGTG
GAGAAGATGAACGCTTTTGCACCCCAACATTCTAGGATTTTCAAGGAAATGATCCTGATAGCCAAACCCTCGAAG
CCATTCAGCTACACACACAAGGGCACTGTCCGTCGTGCTCCCGCCATAAAGGACTATGAGGAAGAAATCAATGCT
TTGTACGACGCTGTAGACAGCAGCTCCCAATCGGCCATGGAGCCGCCTGCCCACTGGGACGATAAATCGGCCGCC
TCATTCATACGTACAGTTGTGGAGAAGCTCGTCGCTGTTCTATTGAAAGACGAAGACGATATTTTCCAACACGGT
TGTGACAGTCTGCAAGCAACCTGGATTCGCAACACCATCCTCCGCGTACTTCGTAACTCTGCGAAGATCGATACC
CGCCAGGTCAATTCCAATTTTGTTTACGACTACCCGACTATCTCGCGCATGGCATCATTTGTCTTGGCTCTTGCC
CTCGGTACTACGGACGGAGAGGACCGGCAGCCAGCGTCGCGCGCTGATGCAATGCGGGCCATGGTGGCTAAATAC
AGCAAGGACTTCCCCATACACCGTGGTAGTGCGGCTGCCAACATGGAATCGGGCAAGGTCGTTTTGATCACTGGC
ACGACCGGAGGCCTTGGATGTTATGCGCTCAAGGAGCTCGTCGCGGACCCCAAGGTCGCTCGAGTTTACGCGTTC
AACCGACCGGCAAAGCATGGTCAAAATCTGTACGAAAGGCAAAAGTCTGCGTTGGTTGACCGTGGACTGGATGCT
AGCATTGTTGATTTTGAGAAAGTGGTACTGCTTGAGGGCGACTTGTCTACAACGCATTTCGACTTGGAAGAGAAA
GTCTTCGAGGAGTTGCATACATCGGTCACGTATATCATCCACAACGCATGGCGTGTGGATTTCAGCATTTCATTG
GCATCATTCGAGTCGAACGTGTACGGCGTGCGTGCGCTTATAGGTTTCACCCTCACGTCGCCGCTGGCGAAACCC
CCAAGGCTAATCTACACCAGCTCAATTGGTGTCTTCACGAATATCGACCGTGATGATAATTTAGTCGAGGCTTCG
ATCAACCCCGACGTCGCCATTGGCAGTGGCTACACGGAGTCAAAATGGGTGTCCGAAGAGATCTTACACAATGCC
GCTGCCAGCACGCCGCTCAATCCTGTGGTCGTTCGAGTTGGACAGATCTGTGGTGCTCTGGAAGGCTCGTGGAAC
GCTCACGAATGGTTTCCGTCCATAGTTCAGAGTGCTGTAAAACTGGGATGTTTCCCCGATGATGAGAGGGGTGTT
GCGTGGGTGCCACTCGACGTTGCCGCGCAAGCCATAGTCGACTTCATGGACACGCCGCTGCATATCAAAGTCGTC
CACCTCAATCACCCGCGGCCTGTTCCGTGGCACTCGCTTGGTGTGCACGTCGCACAGGCTTTCTCAGTGCCTCTT
GTCCCGTACCACGAGTGGCTCGCCAAGCTCGAGCAGGCCGCGCAGGACGTCTCCCAAGCCGAGAGGGAGGGCAGC
CCGACGCGTAAAGCCTTGCAGAACCTACACGGGATCCAGCTGCTCCCGTTCTACCGAGGACTCGCTGCTAAGTTT
AATGTCGGTCGGCTGTCTGTAGGAATGTTCCAGCTCGATGTCTCCCAAGCTGTCGCAGCATCCCCGACGTTGTCA
GCCCCTAGTGTATCTCAACTTGGTGCAGAGCACGTCAAGAACTGGTTGGCATATTGGCGAAAGGTTGGGCTGTTG
GCGGAGCAGTGA
Gene >RhoplFPRL280|117_1
ATGTACACGGCGTCCAAGGTGATCAAGGAGCGTATGCGCACCGAAGGAGCCTTCGACAACAAGACGGTTATCGCT
CTACTTGCATCTTCAGGTACGAACCAACTCCCGTGGACATGTAACAATGTATAGAAGCTAACCGCTCCCTTCGAT
AGATGCCATTCCGTACGCAATCATTGAAATGGCAGTCATTCGTGCCAACTTCGTCGTCTTTCCCCTCTCCATCCG
GAACTCACCTGCCGCTGTGGCGCACTTGTTAAACAAGGCCGGAGTGAAGCACATACTCACTAGTAAGGAGCAGAG
CATCGCCGACCTTGTTCGGGATGCTCTCGATATCTTGAAAACACAATACATCCCCGTGACTATTCCTGGCGTCTC
TTCCGCATTTACATTCGAGGAGTTGTTCTTGTCCCCTTCTAATGGCCTAGCTGCAAGCGAAGAGCTGCCACATGA
TAGCAGGGATCCTGACGCCCCAACAATGATTATGCATTCGTCTGGTGAGACCGGATTACATCATCGCGCATCGTA
TCATTCTGTGCTAACTGCGTGTGCATGTATTTAGGATCAACGGCGTTCCCAAAGCCTATAGTATGGTCCAATCGC
CGTCTGATAGAAATCGCCACCTACCCGTGGTACTTCGAGCGAGAAATTACAGATCTCGTTAGTTCTCTGCATTCT
TTGCCTTTCTTTCACGGCCTCGCATTTGTGAATGTACTGTGGGCGGTACGTACTTTTTGGCAATTCTCTTCCGCC
TCCGTACTAATTGGCTGGAATGTCAGGCATCTGCGGGCCAAACACTTGCTGTTTTTGAGCCTAGGCAACCGCCTC
TTGTGCCCACACCAGACCTTGTATTCCGTGCCCTGCAAGCGTCGAATTGCGACCTTGTGTGGGCTGTGCCGTCAT
TTATTGAGGTAGGTCAATCTCATCATCATGAGATGACCATTTTGACAGAATATCCAGACGTGGGCGCATAATGAA
GAATACATCGAGTGGCTCGCCTCCCACGAGGGCTTGGTGCGTACACTGCGATCCGAAGCAGATAGTTAAAAAATA
AATTATGTGTAGACGTTTGGCGGCGGCCCTCTCAACAAGGAGATCGGCGATATGCTAATCTCAAAAGGCGTACAC
ATATATGATGCCTACGGATGGTATGTACTTTCGCTTGTAACTTTGGTCTACTCCACTAATGGTGGAACGACCAGC
ACCGAAACGGGAATGTTGAACGTGGTCTACGAAGGTGGGATGATGTCTTGATTTACAATATAGTTCACTTATCGC
CACACCATGTAGCCGAACCCCCCATCGAATGGGACTACTTCAGGATTCAGAAGCATATTTCGATTAAAATGCTTC
CTATGGGCGATAATACCTATGAACTTGTTGTCGTTGTGAGCCATCCACTTGCCATGAGCACTGTAATATGAGTTC
ACGAACATCGCTCTAGGCGAATAACTTGCACAGACCCGCTGTCGTTAACACACAAGTCGATGGGGTTGACGGCTA
CGCCACATCGGATCTCGTTGTGCCGCATCCGACGAGGCCCGGCTACTGGAAGATCGTGGGTCGTACTGATGACCA
GATCATGCATAGCACAGGGGAGAAGGCCAGTCTCGCTCTGGTCCGACTGAGTACGCGTACTGACTGCCTAAATAA
TTCATCCAGACAAACCCAGGGCCCCTAGGTGCGCATTTTTGCAGTGCTTCACGTAGTCGTTATCCTGATGGTCCA
CTGTAGAGGAGATATTAAGGAAGGATCCCTATGTGTCCGATTGTATCATTTTCGGTCGCGGGCGGTTTCAAGCTG
GCGTACTAGTTCAGCCAAGGTCCGAAATCAGGCTCGACCTTTCTGACGACGCTCGTGTGGCTAGTTTCAGAAACA
AAATATGGTAATTATGCCGTCGCATTGAACGTTCTGAATTTGACCGCTTCTATGTTCTAGGCCGTCTGTGGAGAA
GATGAACGCTTTTGCACCCCAACATTCTAGGATTTTCAAGGAAGTAAGCGATCAGTGCAATCTTTACCAGCAGCC
ATTGACATTGTCAGTAGATGATCCTGATAGCCAAACCCTCGAAGCCATTCAGCTACACACACAAGGGCACTGTCC
GTCGTGCTCCCGCCATAAAGGACTATGAGGAAGAAATCAATGCTTTGTACGACGCTGTAGACAGCAGCTCCCAAT
CGGCCATGGAGCCGCCTGCCCACTGGGACGATAAATCGGCCGCCTCATTCATACGTACAGTTGTGGAGAAGCTCG
TCGCTGTTCTATTGAAAGACGAAGACGATATTTTCCAACACGGTTGTGACAGGTAAGCACGTTTTGCCACCTCTT
GTATCGACAGGCGCCATACTCAGGCTGCACAGTCTGCAAGCAACCTGGATTCGCAACACCATCCTCCGCGTACTT
CGTAACTCTGCGAAGATCGATACCCGCCAGGTCAATTCCAATTTTGTTTACGACTACCCGACTATCTCGCGCATG
GCATCATTTGTCTTGGCTCTTGCCCTCGGTACTACGGACGGAGAGGACCGGCAGCCAGCGTCGCGCGCTGATGCA
ATGCGGGCCATGGTGGCTAAATACAGCAAGGACTTCCCCATACACCGTGGTAGTGCGGCTGCCAACATGGAATCG
GGCAAGGTCGTTTTGATCACTGGCACGACCGGAGGCCTTGGATGTTATGCGCTCAAGGAGCTCGTCGCGGACCCC
AAGGTCGCTCGAGTTTACGCGTTCAACCGACCGGCAAAGCATGGTCAAAATCTGTACGAAAGGCAAAAGTCTGCG
TTGGTTGACCGTGGACTGGATGCTAGCATTGTTGATTTTGAGAAAGTGGTACTGCTTGAGGGCGACTTGTCTACA
ACGCATTTCGACTTGGAAGAGAAAGTCTTCGAGGAGGTGAATCTCATTTGAGAAGATTACGTGCGCGACACTAAT
AGCAGCTCAGTTGCATACATCGGTCACGTATATCATCCACAACGGTACGTGGTGATCACCCTGGTGATTCCTTTC
ATGCTCAGGGTCGCAATCCAGCATGGCGTGTGGATTTCAGCATTTCATTGGCATCATTCGAGTCGAACGTGTACG
GCGTGCGTGCGCTTATAGGTTTCACCCTCACGTCGCCGCTGGCGAAACCCCCAAGGCTAATCTACACCAGCTCAA
TTGGTGTCTTCACGAGTTGGTGCATCATCGCTTAGCAGGGATACAAGAAGACTAATGTCCATCTCACTTCCTCCT
AGATATCGACCGTGATGATAATTTAGTCGAGGCTTCGATCAACCCCGACGTCGCCATTGGCAGTGGCTACACGGA
GTCAAAATGGGTGTCCGAAGAGATCTTACACAATGCCGCTGCCAGCACGCCGCTCAATCCTGTGGTCGTTCGAGT
TGGACAGATCTGTGGTGCTCTGGAAGGCTCGTGGAACGCTCACGAATGGTTTCCGTCCATAGTTCAGAGTGCTGT
AAAACTGGGATGTTTCCCCGATGATGAGAGGGTACGTCAAGAATCTTCTGAGTCGTTCTGATTCACCAACACTGA
CGCACGTTTCAGGGTGTTGCGTGGGTGCCACTCGACGTTGCCGCGCAAGCCATAGTCGACTTCATGGACACGCCG
CTGCATATCAAAGTCGTCCACCTCAATCACCCGCGGCCTGTTCCGTGGCACTCGCTTGGTGTGCACGTCGCACAG
GCTTTCTCAGTGCCTCTTGTCCCGTACCACGAGTGGCTCGCCAAGCTCGAGCAGGCCGCGCAGGACGTCTCCCAA
GCCGAGAGGGAGGGCAGCCCGACGCGTAAAGCCTTGCAGAACCTACACGGGATCCAGCTGCTCCCGTTCTACCGA
GGACTCGCTGCTAAGTTTAATGTCGGTCGGCTGTCTGTAGGAATGTTCCAGCTCGATGTCTCCCAAGCTGTCGCA
GCATCCCCGACGTTGTCAGCCCCTAGTGTATCTCAACTTGGTGCAGAGCACGTCAAGAACTGGTTGGCATATTGG
CGAAAGGTTGGGCTGTTGGCGGAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail