Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|10_81
Gene name
LocationNODE_10:195351..197322
Strand+
Gene length (bp)1971
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 6.8E-13 176 252
PF08544 GHMP_kinases_C GHMP kinases C terminal 1.5E-07 408 463

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0043167 ion binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup2470
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|046080
Agaricus bisporus var bisporus H97 AgabiH97|046080
Rhodonia placenta FPRL280 RhoplFPRL280|10_81 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|10_81
MATTAISSPGKVLLAGGYLVLDPAYSGVVVSTSARFYTVVQDLDEATTVSRAKADRPIEIRVRSPQFVNAAYTYL
VSFDVDGVHVEQVADSASASFTKNKFVHLALQRTIALAIEARGAGTLQNRLGYGLDITIVGDNDFYSQRAQLTSR
NLPPTLASLSQLPPFNHTGVRLPEVHKTGLGSSAALITSLVSSLLVHLGVVARDSFDNDAEGGTASASEGRRLAH
NLAQYVHCLAQGKVGSGFDVSAAVFGSQLYTRFDPVVLGLLMKDESTNEALLPIISPSNTAWNYRVEPFKLPPLT
RLMLADVDAGSDTPSLVGKVLKWRKEAATAANAHWGALDKVNHALSETLLKLSEMHARDATTYAKAVKYLSTLQS
VQNLYQWLAINPNIPPATQEMIDVFAEAHRLSEDVRAKMREMGKLSGVPIEPPEQTELLDACMSGAGVIGGGVPG
AGGYDAIWLLVLDPTNCPPQELPSSRIEGVWASWKGLDVSPLSASESVAKGVRLETVDQVNGLRQLLDAPW*
Coding >RhoplFPRL280|10_81
ATGGCTACTACTGCAATCTCTTCGCCGGGGAAAGTGCTCCTCGCTGGTGGATATCTCGTGCTGGATCCCGCATAC
TCGGGCGTAGTGGTGTCAACGAGTGCGCGATTCTACACGGTTGTCCAAGATCTCGACGAAGCGACGACGGTCTCA
CGCGCAAAGGCGGACCGCCCGATTGAAATTCGCGTGCGATCGCCTCAGTTCGTTAATGCGGCATACACCTACTTG
GTGTCCTTCGACGTCGACGGGGTGCACGTAGAGCAGGTTGCAGATAGCGCGTCCGCGTCGTTCACGAAGAACAAG
TTCGTACATCTCGCGCTGCAGCGTACGATCGCACTCGCCATTGAGGCAAGAGGGGCGGGGACTTTGCAGAACAGA
CTGGGTTACGGCCTAGACATTACCATTGTTGGAGACAATGACTTCTACTCTCAGAGAGCACAGCTGACCTCAAGG
AACCTTCCGCCGACGCTTGCTTCACTCTCCCAGCTACCCCCCTTCAACCACACCGGCGTGCGCCTCCCGGAAGTG
CACAAAACAGGCCTCGGCTCCTCCGCAGCTCTCATAACCTCCCTCGTGTCCAGCCTGCTCGTGCACCTCGGCGTT
GTCGCACGCGATTCATTCGACAACGACGCAGAAGGCGGTACCGCTTCCGCAAGCGAAGGACGCCGGCTTGCGCAC
AACCTCGCGCAGTACGTACACTGTCTCGCACAGGGCAAGGTCGGCAGCGGCTTCGACGTCTCCGCAGCAGTCTTT
GGCAGTCAACTGTACACGCGCTTCGACCCCGTTGTGTTGGGATTATTGATGAAGGATGAGTCGACAAACGAGGCG
CTCCTGCCCATCATCTCGCCGTCGAACACAGCATGGAACTATCGCGTAGAGCCGTTCAAGCTACCCCCGTTGACA
CGGCTGATGCTTGCGGATGTGGACGCGGGCAGCGACACGCCGTCGCTAGTGGGGAAGGTGCTGAAATGGCGCAAA
GAGGCCGCCACAGCAGCAAACGCGCATTGGGGCGCGTTGGATAAGGTGAACCACGCGCTTAGCGAGACGCTCCTC
AAGCTGTCAGAAATGCACGCGCGAGACGCCACAACGTATGCCAAGGCCGTCAAGTATCTCTCGACCCTGCAAAGC
GTACAGAATCTCTATCAGTGGCTGGCGATCAACCCGAACATACCACCCGCCACGCAAGAGATGATAGACGTCTTC
GCGGAGGCTCATCGTCTGTCCGAAGACGTGCGAGCCAAGATGCGCGAAATGGGCAAGCTGTCTGGCGTCCCGATA
GAGCCACCGGAGCAAACTGAGCTACTCGATGCGTGCATGTCGGGTGCTGGTGTTATCGGTGGCGGTGTCCCTGGA
GCTGGCGGCTACGACGCGATCTGGCTTCTTGTACTCGACCCGACAAATTGTCCGCCGCAGGAACTACCCTCAAGC
CGCATCGAAGGTGTGTGGGCCAGCTGGAAAGGGCTTGATGTCTCCCCGCTGTCTGCATCCGAGAGCGTTGCCAAG
GGTGTGCGACTTGAGACTGTCGACCAAGTCAATGGGCTGAGACAACTCCTCGATGCACCATGGTGA
Transcript >RhoplFPRL280|10_81
ATGGCTACTACTGCAATCTCTTCGCCGGGGAAAGTGCTCCTCGCTGGTGGATATCTCGTGCTGGATCCCGCATAC
TCGGGCGTAGTGGTGTCAACGAGTGCGCGATTCTACACGGTTGTCCAAGATCTCGACGAAGCGACGACGGTCTCA
CGCGCAAAGGCGGACCGCCCGATTGAAATTCGCGTGCGATCGCCTCAGTTCGTTAATGCGGCATACACCTACTTG
GTGTCCTTCGACGTCGACGGGGTGCACGTAGAGCAGGTTGCAGATAGCGCGTCCGCGTCGTTCACGAAGAACAAG
TTCGTACATCTCGCGCTGCAGCGTACGATCGCACTCGCCATTGAGGCAAGAGGGGCGGGGACTTTGCAGAACAGA
CTGGGTTACGGCCTAGACATTACCATTGTTGGAGACAATGACTTCTACTCTCAGAGAGCACAGCTGACCTCAAGG
AACCTTCCGCCGACGCTTGCTTCACTCTCCCAGCTACCCCCCTTCAACCACACCGGCGTGCGCCTCCCGGAAGTG
CACAAAACAGGCCTCGGCTCCTCCGCAGCTCTCATAACCTCCCTCGTGTCCAGCCTGCTCGTGCACCTCGGCGTT
GTCGCACGCGATTCATTCGACAACGACGCAGAAGGCGGTACCGCTTCCGCAAGCGAAGGACGCCGGCTTGCGCAC
AACCTCGCGCAGTACGTACACTGTCTCGCACAGGGCAAGGTCGGCAGCGGCTTCGACGTCTCCGCAGCAGTCTTT
GGCAGTCAACTGTACACGCGCTTCGACCCCGTTGTGTTGGGATTATTGATGAAGGATGAGTCGACAAACGAGGCG
CTCCTGCCCATCATCTCGCCGTCGAACACAGCATGGAACTATCGCGTAGAGCCGTTCAAGCTACCCCCGTTGACA
CGGCTGATGCTTGCGGATGTGGACGCGGGCAGCGACACGCCGTCGCTAGTGGGGAAGGTGCTGAAATGGCGCAAA
GAGGCCGCCACAGCAGCAAACGCGCATTGGGGCGCGTTGGATAAGGTGAACCACGCGCTTAGCGAGACGCTCCTC
AAGCTGTCAGAAATGCACGCGCGAGACGCCACAACGTATGCCAAGGCCGTCAAGTATCTCTCGACCCTGCAAAGC
GTACAGAATCTCTATCAGTGGCTGGCGATCAACCCGAACATACCACCCGCCACGCAAGAGATGATAGACGTCTTC
GCGGAGGCTCATCGTCTGTCCGAAGACGTGCGAGCCAAGATGCGCGAAATGGGCAAGCTGTCTGGCGTCCCGATA
GAGCCACCGGAGCAAACTGAGCTACTCGATGCGTGCATGTCGGGTGCTGGTGTTATCGGTGGCGGTGTCCCTGGA
GCTGGCGGCTACGACGCGATCTGGCTTCTTGTACTCGACCCGACAAATTGTCCGCCGCAGGAACTACCCTCAAGC
CGCATCGAAGGTGTGTGGGCCAGCTGGAAAGGGCTTGATGTCTCCCCGCTGTCTGCATCCGAGAGCGTTGCCAAG
GGTGTGCGACTTGAGACTGTCGACCAAGTCAATGGGCTGAGACAACTCCTCGATGCACCATGGTGA
Gene >RhoplFPRL280|10_81
ATGGCTACTACTGCAATCTCTTCGCCGGGGAAAGTGCTCCTCGCTGGTGGATATCTCGTGCTGGATCCCGCATAC
TCGGGCGTAGTGGTGTCAACGAGTGCGCGATTCTACACGGTTGTCCAAGATCTCGACGAAGCGACGACGGTCTCA
CGCGCAAAGGCGGACCGCCCGATTGAAATTCGCGTGCGATCGCCTCAGTTCGTTAATGCGGCATACACCTACTTG
GTGTCCTTCGACGTCGACGGGGTGCACGTAGAGCAGGTTGCAGATAGGTGAGGGTCATTGTTCAGTGTCCGGCTT
TAACTGACGTCCTGCAGCGCGTCCGCGTCGTTCACGAAGAACAAGTTCGTACATCTCGCGCTGCAGCGTACGATC
GCACTCGCCATTGAGGCAAGAGGGGCGGGGACTTTGCAGAACAGACTGGGTTACGGCCTAGACATTACCATTGTT
GGAGACAATGACTTCTACTCTCAGAGAGCACAGGTCGCTACATTCCACAATCGCGCGTGCAGCTGCTCATGACCG
CCGTTACACATTCTAGCTGACCTCAAGGAACCTTCCGCCGACGCTTGCTTCACTCTCCCAGCTACCCCCCTTCAA
CCACACCGGCGTGCGCCTCCCGGAAGTGCACAAAACAGGCCTCGGCTCCTCCGCAGCTCTCATAACCTCCCTCGT
GTCCAGCCTGCTCGTGCACCTCGGCGTTGTCGCACGCGATTCATTCGACAACGACGCAGAAGGCGGTACCGCTTC
CGCAAGCGAAGGACGCCGGCTTGCGCACAACCTCGCGCAGTACGTACACTGTCTCGCACAGGGCAAGGTCGGCAG
CGGCTTCGACGTCTCCGCAGCAGTCTTTGGCAGTCAACTGTACACGCGCTTCGACCCCGTTGTGTTGGGATTATT
GATGAAGGATGAGTCGGTGAGTTCAGACACAAATTGTTCCGCGATGCTTCTGGTGGCCAATCGCACGTCGCTTAG
ACAAACGAGGCGCTCCTGCCCATCATCTCGCCGTCGAACACAGCATGGAACTATCGCGTAGAGCCGTTCAAGCTA
CCCCCGTTGACACGGCTGATGCTTGCGGATGTGGACGCGGGCAGCGACACGCCGTCGCTAGTGGGGAAGGTGCTG
AAATGGCGCAAAGAGGCCGCCACAGCAGGTGCGTGTTCGCCGCCGCTTCGCCGTCGGTAGTAAATTTGATTTCCG
GTGACCAGCAAACGCGCATTGGGGCGCGTTGGATAAGGTGAACCACGCGCTTAGCGAGACGCTCCTCAAGCTGTC
AGAAATGCACGCGCGAGACGCCACAACGTATGCCAAGGCCGTCAAGTATCTCTCGACCCTGCAAAGCGTACAGGT
GCGTGTTCTACCCTTGTGCACCGCCTTTGGCGCCCTTTTCATGCTTAGAATCTCTATCAGTGGCTGGCGATCAAC
CCGAACATACCACCCGCCACGCAAGAGATGATAGACGTCTTCGCGGAGGCTCATCGTCTGTCCGAAGTACGTGTA
CGCGACATGTGGATGTCCTGGGACACTGACCGTCTTCCATGACGCCTGCCTACAGGACGTGCGAGCCAAGATGCG
CGAAATGGGCAAGCTGTCTGGCGTCCCGATAGAGCCACCGGAGCAAACTGAGCTACTCGATGCGTGCATGTCGGG
TGCTGGTGTTATCGGTGGCGGTGTCCCTGGAGGTCAGCCCTCTCCATTCCGTTCCTGCAGACCACTCGGTGACGT
GCAACTCCGACTGACATTCTCTCACTGGCAGCTGGCGGCTACGACGCGATCTGGCTTCTTGTACTCGACCCGACA
AATTGTCCGCCGCAGGAACTACCCTCAAGCCGCATCGAAGGTGTGTGGGCCAGCTGGAAAGGGCTTGATGTCTCC
CCGCTGTCTGCATCCGAGAGCGTTGCCAAGGGTGTGCGACTTGAGACTGTCGACCAAGTCAATGGGCTGAGACAA
CTCCTCGATGCACCATGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail