Fungal Genomics

at Utrecht University

General Properties

Protein IDRhoplFPRL280|103_1
Gene name
LocationNODE_103:32938..36941
Strand+
Gene length (bp)4003
Transcript length (bp)3087
Coding sequence length (bp)3087
Protein length (aa) 1029

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 7.0E-30 31 297
PF07993 NAD_binding_4 Male sterility protein 1.8E-28 648 887
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.4E-06 646 846

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >RhoplFPRL280|103_1
MYAGAKMIKERMRAEGPFDNNTVIALLASSDAIPYAITEMAIIRANFVVFPLSTRNSPAAIAHLLNKVDAKHILA
SKEQSITDLVRDALDIMRTEYSPATIPTVSSTFTFEELFSSPSNGLVTSEELPHNSREPDAPALILHSSGSTAFP
KPIVWTNRRLIEVATYPWHFGQDLTGLVSSLHTLPIFHGLAFVNLLWAASTGNILAAFEPRQPPLVPTPDLVFRA
LQASNCDLVWAVPSFVETWAHNDEYVEWLASRKGVTFGGGPLNKEIGDMLVSRGVNIYNAYGSTEAGMLSVVYEA
EPLIEWDYFKIHDYISIQMLPMGDNTYELAVVANNVHKPAVINTKVDGDDAYATSDLVMPHPTKSGYWKVLGRTD
DQIMHSTGEKASLALTNPGPLEDILKKDPYVSNCIMFGRGRFQAGVLVQPKSEFSLDPSDDTRVAEFRNKIWPSV
EKMNAFAPQHSRIFKEMILIANPSKPFSYTPKGTVRRAPVIKDYEEEIDALYDAVDNSAQSATEPPVHWDDKSAN
SFTRAVVEKLITVPLKDEDDIFQHGCDSLQATWIRNTILRALRDSAKIDTRKVNSNFVYDHPTISRMASFVLALA
LGTTDGEDRQSVSHADAMRAMVAKYSKDFPIHRGSAAANMESGKVVLITGTTGGLGCYALKELVADPKVARVYAF
NRPAKHGQTLYERQKYALADRGLDASIVDSEKVVLLEGDLSAANFGLTEKVYQELHTSVTYIIHNAWRVDFSISL
ASFESNVYGVRAFIDFALTSPLAHSPRLIYTSSIGVFTNLDSDDDLVEAPIDPDVAIGSGYTESKWVSEEILYNA
AANTPLTPVVVRVGQICGALEGSWNAHEWFPSIVQSAPKLGCFPDDERGVVWVPLDVAAQAMVDFMDTPPHIKVV
HLNHPRPVSWHSLAVHVAQAFSVPLVPYHEWLAKLEQAALDVSQAESAGSDSRKALQDLHAIQLLPFYRGLAANF
NVGRLSVGMFQLDVSQAVAASPTLSDPNVSQLGAEHVKNWLAYWRKVGLLAGQ*
Coding >RhoplFPRL280|103_1
ATGTACGCGGGGGCCAAGATGATCAAGGAGCGCATGCGCGCCGAAGGACCTTTCGATAACAACACCGTTATCGCT
CTACTTGCATCCTCAGATGCCATTCCGTACGCAATCACTGAAATGGCAATTATTCGAGCCAACTTCGTCGTCTTC
CCTCTCTCCACCCGGAACTCGCCTGCCGCCATAGCTCACCTACTGAACAAGGTTGACGCGAAGCACATACTCGCT
AGTAAAGAGCAGAGCATTACCGATCTTGTTCGGGATGCTCTCGATATAATGAGAACAGAATACTCACCCGCGACT
ATTCCCACCGTCTCTTCCACATTTACGTTTGAGGAGCTGTTTTCGTCCCCTTCCAACGGCCTAGTTACAAGCGAA
GAGCTACCGCATAATAGCAGGGAACCTGACGCCCCAGCCTTGATCCTGCATTCGTCTGGATCGACGGCGTTCCCC
AAGCCTATAGTATGGACCAATCGCCGCCTGATAGAAGTCGCCACCTACCCGTGGCACTTCGGGCAAGATCTCACA
GGTCTCGTCAGTTCTCTGCATACATTGCCTATCTTCCACGGCCTCGCTTTTGTGAATTTACTATGGGCGGCATCT
ACGGGAAATATACTTGCTGCTTTTGAGCCTAGGCAGCCGCCTCTTGTGCCCACACCAGACCTTGTATTCCGTGCC
CTACAAGCGTCAAATTGTGACCTTGTCTGGGCTGTGCCGTCGTTTGTTGAGACATGGGCGCATAACGATGAATAC
GTCGAGTGGCTCGCCTCTCGCAAGGGCGTGACGTTTGGCGGTGGCCCTCTCAACAAGGAGATCGGCGACATGCTA
GTCTCAAGAGGCGTGAATATATACAATGCCTACGGATCCACCGAAGCGGGGATGTTGAGCGTCGTCTACGAAGCC
GAACCTCTGATCGAATGGGACTACTTCAAGATTCATGATTATATCTCAATACAAATGCTACCTATGGGCGATAAT
ACCTATGAACTTGCTGTCGTGGCCAACAACGTGCATAAACCTGCTGTCATCAATACAAAAGTCGATGGGGATGAT
GCCTACGCCACATCGGATCTCGTTATGCCGCATCCGACGAAGTCCGGCTATTGGAAGGTTCTGGGTCGTACTGAT
GACCAGATCATGCATAGCACAGGGGAGAAGGCGAGTCTCGCTCTGACAAACCCAGGGCCCTTAGAGGATATATTG
AAGAAGGACCCCTATGTATCCAATTGCATCATGTTCGGTCGCGGGCGGTTCCAAGCTGGCGTACTAGTTCAGCCA
AAGTCCGAATTCAGCCTCGACCCCTCTGATGATACTCGCGTCGCTGAATTCAGAAACAAGATATGGCCGTCAGTG
GAGAAGATGAACGCTTTTGCACCCCAACATTCTAGGATCTTCAAGGAGATGATTCTGATCGCCAACCCCTCAAAG
CCATTCAGCTACACACCCAAGGGCACTGTCCGCCGTGCTCCCGTCATAAAAGACTATGAGGAAGAGATCGACGCG
TTGTACGACGCTGTGGACAACAGCGCTCAGTCGGCCACGGAGCCGCCTGTCCACTGGGACGATAAATCGGCCAAC
TCATTCACACGCGCAGTCGTGGAGAAGCTCATCACTGTTCCCTTGAAAGACGAAGACGATATCTTCCAGCACGGT
TGTGACAGTCTGCAAGCAACCTGGATTCGCAACACCATCCTCCGTGCACTACGTGACTCTGCGAAAATCGATACC
CGCAAAGTCAATTCCAACTTTGTCTACGACCACCCGACTATTTCGCGCATGGCATCATTTGTCTTAGCTCTCGCC
CTCGGTACTACAGACGGAGAGGACCGGCAGTCGGTGTCGCACGCGGATGCAATGCGTGCCATGGTGGCTAAATAC
AGCAAGGACTTCCCCATACACCGGGGTAGCGCGGCTGCCAACATGGAATCGGGCAAGGTCGTTTTGATCACCGGC
ACAACCGGAGGCCTTGGATGTTACGCGCTCAAAGAGCTTGTCGCGGATCCCAAGGTTGCCCGAGTGTACGCGTTC
AACCGACCGGCAAAGCATGGTCAAACTCTGTACGAGAGGCAAAAATATGCATTGGCCGACCGTGGACTGGATGCC
AGCATTGTCGACTCTGAGAAAGTGGTACTCCTCGAGGGGGACTTGTCTGCAGCGAATTTCGGCTTGACAGAGAAA
GTCTACCAAGAGTTGCATACATCGGTCACATATATCATCCACAACGCATGGCGTGTGGATTTCAGCATTTCCTTG
GCGTCATTCGAGTCGAACGTGTACGGCGTGCGTGCGTTCATAGATTTTGCCCTCACGTCGCCGCTGGCCCATTCC
CCACGGCTGATCTACACCAGCTCAATTGGTGTCTTCACGAATCTCGATAGTGACGATGATTTAGTCGAGGCTCCG
ATTGACCCCGACGTCGCCATTGGCAGCGGTTACACCGAGTCAAAATGGGTGTCCGAAGAGATCCTTTACAACGCC
GCTGCCAACACGCCGCTGACGCCTGTGGTCGTCCGAGTTGGACAGATCTGTGGTGCTCTGGAAGGCTCGTGGAAC
GCCCACGAATGGTTCCCGTCCATAGTTCAGAGTGCCCCAAAGCTGGGATGTTTCCCTGACGATGAGAGGGGTGTT
GTGTGGGTGCCACTCGACGTGGCCGCGCAAGCCATGGTCGACTTCATGGACACACCGCCGCATATCAAAGTTGTC
CACCTCAACCACCCGCGGCCTGTCTCGTGGCACTCGCTGGCTGTGCACGTCGCACAGGCTTTCTCAGTGCCTCTT
GTCCCGTACCACGAGTGGCTCGCCAAGCTCGAGCAGGCCGCGCTGGACGTCTCCCAAGCCGAGAGCGCGGGCAGT
GACTCGCGCAAGGCCCTGCAGGACCTGCACGCGATCCAGCTGCTCCCGTTCTACCGCGGGCTCGCTGCCAATTTC
AACGTCGGTCGGCTCTCTGTAGGGATGTTCCAGCTTGATGTCTCCCAAGCCGTCGCAGCATCCCCAACACTGTCA
GACCCTAACGTGTCTCAACTCGGTGCCGAGCACGTCAAGAATTGGTTGGCATATTGGCGAAAGGTTGGGCTGTTG
GCGGGGCAGTAA
Transcript >RhoplFPRL280|103_1
ATGTACGCGGGGGCCAAGATGATCAAGGAGCGCATGCGCGCCGAAGGACCTTTCGATAACAACACCGTTATCGCT
CTACTTGCATCCTCAGATGCCATTCCGTACGCAATCACTGAAATGGCAATTATTCGAGCCAACTTCGTCGTCTTC
CCTCTCTCCACCCGGAACTCGCCTGCCGCCATAGCTCACCTACTGAACAAGGTTGACGCGAAGCACATACTCGCT
AGTAAAGAGCAGAGCATTACCGATCTTGTTCGGGATGCTCTCGATATAATGAGAACAGAATACTCACCCGCGACT
ATTCCCACCGTCTCTTCCACATTTACGTTTGAGGAGCTGTTTTCGTCCCCTTCCAACGGCCTAGTTACAAGCGAA
GAGCTACCGCATAATAGCAGGGAACCTGACGCCCCAGCCTTGATCCTGCATTCGTCTGGATCGACGGCGTTCCCC
AAGCCTATAGTATGGACCAATCGCCGCCTGATAGAAGTCGCCACCTACCCGTGGCACTTCGGGCAAGATCTCACA
GGTCTCGTCAGTTCTCTGCATACATTGCCTATCTTCCACGGCCTCGCTTTTGTGAATTTACTATGGGCGGCATCT
ACGGGAAATATACTTGCTGCTTTTGAGCCTAGGCAGCCGCCTCTTGTGCCCACACCAGACCTTGTATTCCGTGCC
CTACAAGCGTCAAATTGTGACCTTGTCTGGGCTGTGCCGTCGTTTGTTGAGACATGGGCGCATAACGATGAATAC
GTCGAGTGGCTCGCCTCTCGCAAGGGCGTGACGTTTGGCGGTGGCCCTCTCAACAAGGAGATCGGCGACATGCTA
GTCTCAAGAGGCGTGAATATATACAATGCCTACGGATCCACCGAAGCGGGGATGTTGAGCGTCGTCTACGAAGCC
GAACCTCTGATCGAATGGGACTACTTCAAGATTCATGATTATATCTCAATACAAATGCTACCTATGGGCGATAAT
ACCTATGAACTTGCTGTCGTGGCCAACAACGTGCATAAACCTGCTGTCATCAATACAAAAGTCGATGGGGATGAT
GCCTACGCCACATCGGATCTCGTTATGCCGCATCCGACGAAGTCCGGCTATTGGAAGGTTCTGGGTCGTACTGAT
GACCAGATCATGCATAGCACAGGGGAGAAGGCGAGTCTCGCTCTGACAAACCCAGGGCCCTTAGAGGATATATTG
AAGAAGGACCCCTATGTATCCAATTGCATCATGTTCGGTCGCGGGCGGTTCCAAGCTGGCGTACTAGTTCAGCCA
AAGTCCGAATTCAGCCTCGACCCCTCTGATGATACTCGCGTCGCTGAATTCAGAAACAAGATATGGCCGTCAGTG
GAGAAGATGAACGCTTTTGCACCCCAACATTCTAGGATCTTCAAGGAGATGATTCTGATCGCCAACCCCTCAAAG
CCATTCAGCTACACACCCAAGGGCACTGTCCGCCGTGCTCCCGTCATAAAAGACTATGAGGAAGAGATCGACGCG
TTGTACGACGCTGTGGACAACAGCGCTCAGTCGGCCACGGAGCCGCCTGTCCACTGGGACGATAAATCGGCCAAC
TCATTCACACGCGCAGTCGTGGAGAAGCTCATCACTGTTCCCTTGAAAGACGAAGACGATATCTTCCAGCACGGT
TGTGACAGTCTGCAAGCAACCTGGATTCGCAACACCATCCTCCGTGCACTACGTGACTCTGCGAAAATCGATACC
CGCAAAGTCAATTCCAACTTTGTCTACGACCACCCGACTATTTCGCGCATGGCATCATTTGTCTTAGCTCTCGCC
CTCGGTACTACAGACGGAGAGGACCGGCAGTCGGTGTCGCACGCGGATGCAATGCGTGCCATGGTGGCTAAATAC
AGCAAGGACTTCCCCATACACCGGGGTAGCGCGGCTGCCAACATGGAATCGGGCAAGGTCGTTTTGATCACCGGC
ACAACCGGAGGCCTTGGATGTTACGCGCTCAAAGAGCTTGTCGCGGATCCCAAGGTTGCCCGAGTGTACGCGTTC
AACCGACCGGCAAAGCATGGTCAAACTCTGTACGAGAGGCAAAAATATGCATTGGCCGACCGTGGACTGGATGCC
AGCATTGTCGACTCTGAGAAAGTGGTACTCCTCGAGGGGGACTTGTCTGCAGCGAATTTCGGCTTGACAGAGAAA
GTCTACCAAGAGTTGCATACATCGGTCACATATATCATCCACAACGCATGGCGTGTGGATTTCAGCATTTCCTTG
GCGTCATTCGAGTCGAACGTGTACGGCGTGCGTGCGTTCATAGATTTTGCCCTCACGTCGCCGCTGGCCCATTCC
CCACGGCTGATCTACACCAGCTCAATTGGTGTCTTCACGAATCTCGATAGTGACGATGATTTAGTCGAGGCTCCG
ATTGACCCCGACGTCGCCATTGGCAGCGGTTACACCGAGTCAAAATGGGTGTCCGAAGAGATCCTTTACAACGCC
GCTGCCAACACGCCGCTGACGCCTGTGGTCGTCCGAGTTGGACAGATCTGTGGTGCTCTGGAAGGCTCGTGGAAC
GCCCACGAATGGTTCCCGTCCATAGTTCAGAGTGCCCCAAAGCTGGGATGTTTCCCTGACGATGAGAGGGGTGTT
GTGTGGGTGCCACTCGACGTGGCCGCGCAAGCCATGGTCGACTTCATGGACACACCGCCGCATATCAAAGTTGTC
CACCTCAACCACCCGCGGCCTGTCTCGTGGCACTCGCTGGCTGTGCACGTCGCACAGGCTTTCTCAGTGCCTCTT
GTCCCGTACCACGAGTGGCTCGCCAAGCTCGAGCAGGCCGCGCTGGACGTCTCCCAAGCCGAGAGCGCGGGCAGT
GACTCGCGCAAGGCCCTGCAGGACCTGCACGCGATCCAGCTGCTCCCGTTCTACCGCGGGCTCGCTGCCAATTTC
AACGTCGGTCGGCTCTCTGTAGGGATGTTCCAGCTTGATGTCTCCCAAGCCGTCGCAGCATCCCCAACACTGTCA
GACCCTAACGTGTCTCAACTCGGTGCCGAGCACGTCAAGAATTGGTTGGCATATTGGCGAAAGGTTGGGCTGTTG
GCGGGGCAGTAA
Gene >RhoplFPRL280|103_1
ATGTACGCGGGGGCCAAGATGATCAAGGAGCGCATGCGCGCCGAAGGACCTTTCGATAACAACACCGTTATCGCT
CTACTTGCATCCTCAGGTACGAACCCCCGTAGATGATTCAATGTATAAGAGCTGATCGCCTCCTTCGATAGATGC
CATTCCGTACGCAATCACTGAAATGGCAATTATTCGAGCCAACTTCGTCGTCTTCCCTCTCTCCACCCGGAACTC
GCCTGCCGCCATAGCTCACCTACTGAACAAGGTTGACGCGAAGCACATACTCGCTAGTAAAGAGCAGAGCATTAC
CGATCTTGTTCGGGATGCTCTCGATATAATGAGAACAGAATACTCACCCGCGACTATTCCCACCGTCTCTTCCAC
ATTTACGTTTGAGGAGCTGTTTTCGTCCCCTTCCAACGGCCTAGTTACAAGCGAAGAGCTACCGCATAATAGCAG
GGAACCTGACGCCCCAGCCTTGATCCTGCATTCGTCTGGTGAGACCGGATTGCGTTGTTGCGTATCGTATCATGC
TGTGCTAATTGCGTGTGCACATAATCAGGATCGACGGCGTTCCCCAAGCCTATAGTATGGACCAATCGCCGCCTG
ATAGAAGTCGCCACCTACCCGTGGCACTTCGGGCAAGATCTCACAGGTCTCGTCAGTTCTCTGCATACATTGCCT
ATCTTCCACGGCCTCGCTTTTGTGAATTTACTATGGGCGGTACGTACTTCTTGGCGGTTCTCTTCCGCCTCCGTA
CTAACTGGCCGAATTGTCAGGCATCTACGGGAAATATACTTGCTGCTTTTGAGCCTAGGCAGCCGCCTCTTGTGC
CCACACCAGACCTTGTATTCCGTGCCCTACAAGCGTCAAATTGTGACCTTGTCTGGGCTGTGCCGTCGTTTGTTG
AGGTAGGTCATTTCCCATCAGACGATGATGATAATCCTGACAGTATACCAAGACATGGGCGCATAACGATGAATA
CGTCGAGTGGCTCGCCTCTCGCAAGGGCGTGGTGCGTATACTGCGATCCGAATAAGTTAGTAAAAAATTAAATAT
CTGGGTAGACGTTTGGCGGTGGCCCTCTCAACAAGGAGATCGGCGACATGCTAGTCTCAAGAGGCGTGAATATAT
ACAATGCCTACGGATCGTATGTACTTCCGCTTTTTAATTTCGGTCTGCCCCACTCATGGTGGAATGCCCAGCACC
GAAGCGGGGATGTTGAGCGTCGTCTACGAAGGTGAGATGATTGCTTGATTAACAAACCGCTTACTCATTGCAATA
CCATATAGCCGAACCTCTGATCGAATGGGACTACTTCAAGATTCATGATTATATCTCAATACAAATGCTACCTAT
GGGCGATAATACCTATGAACTTGCTGTCGTGGTGAGCAATCTACTTGTCATGAGCATTGAAATATGGGCTCACGA
TGGCCACCCCAGGCCAACAACGTGCATAAACCTGCTGTCATCAATACAAAAGTCGATGGGGATGATGCCTACGCC
ACATCGGATCTCGTTATGCCGCATCCGACGAAGTCCGGCTATTGGAAGGTTCTGGGTCGTACTGATGACCAGATC
ATGCATAGCACAGGGGAGAAGGCGAGTCTCGCTCTGGTCTGACTGCGTGCGCGCCCTAACTCCTTGAAATATTTT
GTTCAGACAAACCCAGGGCCCTTAGGTGCGCATTTTGCCAGCGGTACACGTGGTTGCCATTCTGATGGTCCACTG
TAGAGGATATATTGAAGAAGGACCCCTATGTATCCAATTGCATCATGTTCGGTCGCGGGCGGTTCCAAGCTGGCG
TACTAGTTCAGCCAAAGTCCGAATTCAGCCTCGACCCCTCTGATGATACTCGCGTCGCTGAATTCAGAAACAAGA
TATGGTAGTTACGCCTTCGCATTGAACGTTCTGAATCTGACCGCTTCTATTTTCTAGGCCGTCAGTGGAGAAGAT
GAACGCTTTTGCACCCCAACATTCTAGGATCTTCAAGGAGGTAAGCGATAAGTGCAACCTTCACCAACGGCCATT
GACATTGTCAGTAGATGATTCTGATCGCCAACCCCTCAAAGCCATTCAGCTACACACCCAAGGGCACTGTCCGCC
GTGCTCCCGTCATAAAAGACTATGAGGAAGAGATCGACGCGTTGTACGACGCTGTGGACAACAGCGCTCAGTCGG
CCACGGAGCCGCCTGTCCACTGGGACGATAAATCGGCCAACTCATTCACACGCGCAGTCGTGGAGAAGCTCATCA
CTGTTCCCTTGAAAGACGAAGACGATATCTTCCAGCACGGTTGTGACAGGTAAGCACATTTTGCTACACCTTGTA
TCGACAGGCACCATACTCAGGCTGCACAGTCTGCAAGCAACCTGGATTCGCAACACCATCCTCCGTGCACTACGT
GACTCTGCGAAAATCGATACCCGCAAAGTCAATTCCAACTTTGTCTACGACCACCCGACTATTTCGCGCATGGCA
TCATTTGTCTTAGCTCTCGCCCTCGGTACTACAGACGGAGAGGACCGGCAGTCGGTGTCGCACGCGGATGCAATG
CGTGCCATGGTGGCTAAATACAGCAAGGACTTCCCCATACACCGGGGTAGCGCGGCTGCCAACATGGAATCGGGC
AAGGTCGTTTTGATCACCGGCACAACCGGAGGCCTTGGATGTTACGCGCTCAAAGAGCTTGTCGCGGATCCCAAG
GTTGCCCGAGTGTACGCGTTCAACCGACCGGCAAAGCATGGTCAAACTCTGTACGAGAGGCAAAAATATGCATTG
GCCGACCGTGGACTGGATGCCAGCATTGTCGACTCTGAGAAAGTGGTACTCCTCGAGGGGGACTTGTCTGCAGCG
AATTTCGGCTTGACAGAGAAAGTCTACCAAGAGGTGAGTCCCCTTGGAAAAATGTTGTGTGCGCGGCGCTAAGAG
CGGCTTAGTTGCATACATCGGTCACATATATCATCCACAACGGTAAGTGGCGATCACACTGGTAATTTTCATCGT
GCTCAGGGTCGCAATACAGCATGGCGTGTGGATTTCAGCATTTCCTTGGCGTCATTCGAGTCGAACGTGTACGGC
GTGCGTGCGTTCATAGATTTTGCCCTCACGTCGCCGCTGGCCCATTCCCCACGGCTGATCTACACCAGCTCAATT
GGTGTCTTCACGAGTTAGTCCATCATCGCTTGGCAGGGATATAAGAAGATTAATGACCACCTCACTTCCTCCTAG
ATCTCGATAGTGACGATGATTTAGTCGAGGCTCCGATTGACCCCGACGTCGCCATTGGCAGCGGTTACACCGAGT
CAAAATGGGTGTCCGAAGAGATCCTTTACAACGCCGCTGCCAACACGCCGCTGACGCCTGTGGTCGTCCGAGTTG
GACAGATCTGTGGTGCTCTGGAAGGCTCGTGGAACGCCCACGAATGGTTCCCGTCCATAGTTCAGAGTGCCCCAA
AGCTGGGATGTTTCCCTGACGATGAGAGGGTATGTCAGGAACCTTCTAGCTCGCTTCGAATCATCGAGACTGACG
CATGTTTCAGGGTGTTGTGTGGGTGCCACTCGACGTGGCCGCGCAAGCCATGGTCGACTTCATGGACACACCGCC
GCATATCAAAGTTGTCCACCTCAACCACCCGCGGCCTGTCTCGTGGCACTCGCTGGCTGTGCACGTCGCACAGGC
TTTCTCAGTGCCTCTTGTCCCGTACCACGAGTGGCTCGCCAAGCTCGAGCAGGCCGCGCTGGACGTCTCCCAAGC
CGAGAGCGCGGGCAGTGACTCGCGCAAGGCCCTGCAGGACCTGCACGCGATCCAGCTGCTCCCGTTCTACCGCGG
GCTCGCTGCCAATTTCAACGTCGGTCGGCTCTCTGTAGGGATGTTCCAGCTTGATGTCTCCCAAGCCGTCGCAGC
ATCCCCAACACTGTCAGACCCTAACGTGTCTCAACTCGGTGCCGAGCACGTCAAGAATTGGTTGGCATATTGGCG
AAAGGTTGGGCTGTTGGCGGGGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail