Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g994.t1
Gene name
Locationscaffold_01:2650230..2652452
Strand-
Gene length (bp)2222
Transcript length (bp)2157
Coding sequence length (bp)2157
Protein length (aa) 719

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14629 ORC4_C Origin recognition complex (ORC) subunit 4 C-terminus 4.4E-48 468 705
PF13191 AAA_16 AAA ATPase domain 1.9E-16 266 430
PF00004 AAA ATPase family associated with various cellular activities (AAA) 4.7E-08 292 453
PF05729 NACHT NACHT domain 6.0E-07 292 445
PF07693 KAP_NTPase KAP family P-loop domain 1.5E-04 276 363

GO

GO Term Description Terminal node
GO:0016887 ATP hydrolysis activity Yes
GO:0005524 ATP binding Yes
GO:0005488 binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016462 pyrophosphatase activity No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 16.54 8.95 24.12
5d_25C Five days - 25 degrees Celsius 13.76 7.07 20.45
7d_25C Seven days - 25 degrees Celsius 10.52 5.01 16.03
10d_25C Ten days - 25 degrees Celsius 7.64 3.33 11.96
7d_15C Seven days - 15 degrees Celsius 11.83 5.88 17.79
7d_30C Seven days - 30 degrees Celsius 12.18 6.05 18.31

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.557573 no
3d_25C 7d_25C 0.093704 no
3d_25C 7d_15C 0.230256 no
3d_25C 7d_30C 0.278288 no
3d_25C 10d_25C 0.002297 yes
5d_25C 7d_25C 0.384457 no
5d_25C 7d_15C 0.666594 no
5d_25C 7d_30C 0.735684 no
5d_25C 10d_25C 0.038184 yes
7d_25C 7d_15C 0.755658 no
7d_25C 7d_30C 0.684487 no
7d_25C 10d_25C 0.331648 no
7d_15C 7d_30C 0.947906 no
7d_15C 10d_25C 0.148082 no
7d_30C 10d_25C 0.114502 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g994.t1
MPRASKRRRVSEDVDGDIDMGNDDQDVFSVPTSPDNHGISPTPVKSASRRQTTRGDNPDPVTTGQGGEVEEDEAQ
TPARIGTRSSGRQRKTPKRYDQEAVTPSSRRKQAATPSRSARPTRSAQKLRQSPVEDEEEDEPEFKEEDDDDDDM
DLDEPSPEPAPRTITRTRSKRSTAKPRSKKALVAEPKEKSPSPGYQDGLDDIDTIQLQQDLYHDQPEAHETIDVS
EPLPEYAGKFQALCQTGLGDEMRILSTILLEKLTGKRQIPVRGLEAEYQKVHQLIEQTVSIGEGNSMLLLGSRGC
GKTAIVESIISSLRKEHCNEFHVVRLNGFLHTDDRLALREMWRQLGRETHTEEDAAKVSSYADTMATLLALLSHP
EELFGTSGDPGSKTAAKSIVILLDEFDLFVTHPRQTLLYNLFDIAQARKAPITVIGLTTKVDVTEMLEKRVKSRF
SHRYTYVPLPRSFEAFSDICLGSLDLSDAEMVDIADELGSERILVESNKWNTLLGGWKEYLKHLWNDNEFQFHLK
RIYNQTKSAKEFFNSALLPIGDLLQSVSTADAPIPEVPTPKSFSSQSLECPDPAPLPFSTSITSSSPSSLPLALL
VAATRLAALFDPGNDGSQSQSMGPLALSFPAAYAEYVRLLTSAKVSASVSGASATPGRVWGRDVARESWERLLSW
GLVTPVGSGNGTADGQMFRVEISFEEVIEMAGSGGALGQWWRG*
Coding >Pro_DTO377G3_2|g994.t1
ATGCCCCGAGCATCTAAGAGGAGAAGGGTCTCCGAGGACGTTGATGGAGACATCGATATGGGAAATGATGATCAA
GACGTATTCTCCGTCCCGACATCCCCCGACAATCACGGAATTTCTCCCACACCGGTGAAAAGTGCATCGCGGCGT
CAAACTACCCGCGGAGACAACCCAGACCCCGTAACGACGGGCCAAGGCGGCGAGGTTGAGGAAGATGAAGCACAA
ACTCCCGCACGAATTGGGACACGGTCAAGTGGGCGGCAACGCAAAACACCAAAAAGGTACGACCAAGAAGCCGTA
ACACCCTCATCGAGGAGAAAACAAGCAGCCACTCCTTCGAGAAGTGCGCGTCCCACACGAAGCGCGCAAAAGCTG
CGGCAATCCCCGGTAGAAGACGAAGAAGAAGACGAACCTGAATTTAAAGAGGAAGATGATGACGATGATGACATG
GACCTCGACGAGCCGTCCCCGGAACCCGCCCCTCGTACAATTACAAGGACCAGATCGAAGAGAAGCACCGCGAAG
CCTAGATCCAAGAAAGCCTTGGTCGCAGAGCCGAAAGAGAAGTCACCTTCGCCTGGGTATCAGGACGGCTTGGAT
GACATCGATACAATACAACTCCAGCAAGACCTTTATCATGACCAGCCGGAGGCGCATGAGACTATCGATGTCTCC
GAGCCGTTGCCGGAATATGCTGGAAAATTCCAGGCGCTCTGTCAGACGGGCCTTGGGGACGAAATGCGCATTCTC
TCGACTATTCTTCTCGAAAAGCTGACAGGGAAACGACAGATTCCAGTGCGGGGACTCGAAGCTGAATACCAGAAG
GTTCATCAGCTCATTGAACAGACCGTCTCTATCGGAGAGGGCAACTCCATGCTTCTTCTTGGATCCAGGGGATGC
GGCAAGACGGCGATTGTGGAATCTATCATTTCGTCTCTTAGAAAGGAGCATTGCAATGAGTTTCACGTCGTTCGT
CTCAATGGGTTCTTGCACACAGACGACCGTCTAGCTTTGCGAGAAATGTGGCGCCAACTTGGCCGTGAGACGCAT
ACCGAGGAAGATGCGGCTAAGGTCAGTTCTTATGCGGATACGATGGCCACGCTCTTGGCTTTATTGTCACATCCA
GAGGAACTCTTCGGGACTTCTGGGGACCCAGGATCGAAGACTGCTGCGAAATCCATTGTGATCTTGTTGGATGAG
TTCGACCTATTCGTCACTCACCCACGACAGACTTTGTTGTATAATCTGTTCGATATTGCCCAAGCCCGCAAAGCC
CCCATCACGGTGATTGGGCTCACGACAAAGGTCGACGTAACCGAAATGCTCGAGAAGCGTGTCAAGAGTCGATTT
AGTCATCGTTATACTTACGTTCCTCTACCTCGATCCTTCGAGGCCTTTTCAGATATCTGCCTAGGGAGCCTGGAT
CTCAGTGACGCCGAAATGGTTGATATTGCAGATGAACTTGGGTCTGAACGCATTCTAGTAGAGTCGAACAAGTGG
AATACACTGCTTGGGGGATGGAAGGAATATTTGAAGCATTTGTGGAATGACAACGAATTTCAATTCCACCTCAAG
CGTATCTACAACCAAACCAAATCAGCAAAGGAGTTTTTCAACAGCGCGCTTCTCCCCATCGGCGACTTGCTACAA
AGTGTGTCGACCGCCGACGCACCTATACCCGAAGTCCCAACCCCGAAAAGCTTCTCTTCCCAATCCCTTGAGTGC
CCAGACCCAGCACCTCTCCCATTCTCCACATCCATCACATCATCCAGTCCCTCGTCATTGCCACTGGCTTTGTTG
GTAGCCGCAACACGCTTGGCAGCCCTGTTCGACCCCGGAAACGACGGGTCCCAGTCACAGAGCATGGGACCACTT
GCGCTTTCATTCCCCGCCGCATACGCAGAATACGTTCGGCTCCTGACATCCGCAAAGGTATCTGCCTCGGTGTCG
GGAGCTTCTGCCACACCAGGCCGTGTCTGGGGCCGAGATGTGGCCCGAGAGTCTTGGGAAAGACTGCTCAGCTGG
GGACTCGTGACACCCGTGGGTAGTGGGAACGGCACTGCTGACGGGCAGATGTTCCGTGTGGAAATTAGTTTCGAG
GAGGTCATTGAAATGGCTGGCTCTGGGGGTGCATTGGGCCAGTGGTGGCGCGGATAG
Transcript >Pro_DTO377G3_2|g994.t1
ATGCCCCGAGCATCTAAGAGGAGAAGGGTCTCCGAGGACGTTGATGGAGACATCGATATGGGAAATGATGATCAA
GACGTATTCTCCGTCCCGACATCCCCCGACAATCACGGAATTTCTCCCACACCGGTGAAAAGTGCATCGCGGCGT
CAAACTACCCGCGGAGACAACCCAGACCCCGTAACGACGGGCCAAGGCGGCGAGGTTGAGGAAGATGAAGCACAA
ACTCCCGCACGAATTGGGACACGGTCAAGTGGGCGGCAACGCAAAACACCAAAAAGGTACGACCAAGAAGCCGTA
ACACCCTCATCGAGGAGAAAACAAGCAGCCACTCCTTCGAGAAGTGCGCGTCCCACACGAAGCGCGCAAAAGCTG
CGGCAATCCCCGGTAGAAGACGAAGAAGAAGACGAACCTGAATTTAAAGAGGAAGATGATGACGATGATGACATG
GACCTCGACGAGCCGTCCCCGGAACCCGCCCCTCGTACAATTACAAGGACCAGATCGAAGAGAAGCACCGCGAAG
CCTAGATCCAAGAAAGCCTTGGTCGCAGAGCCGAAAGAGAAGTCACCTTCGCCTGGGTATCAGGACGGCTTGGAT
GACATCGATACAATACAACTCCAGCAAGACCTTTATCATGACCAGCCGGAGGCGCATGAGACTATCGATGTCTCC
GAGCCGTTGCCGGAATATGCTGGAAAATTCCAGGCGCTCTGTCAGACGGGCCTTGGGGACGAAATGCGCATTCTC
TCGACTATTCTTCTCGAAAAGCTGACAGGGAAACGACAGATTCCAGTGCGGGGACTCGAAGCTGAATACCAGAAG
GTTCATCAGCTCATTGAACAGACCGTCTCTATCGGAGAGGGCAACTCCATGCTTCTTCTTGGATCCAGGGGATGC
GGCAAGACGGCGATTGTGGAATCTATCATTTCGTCTCTTAGAAAGGAGCATTGCAATGAGTTTCACGTCGTTCGT
CTCAATGGGTTCTTGCACACAGACGACCGTCTAGCTTTGCGAGAAATGTGGCGCCAACTTGGCCGTGAGACGCAT
ACCGAGGAAGATGCGGCTAAGGTCAGTTCTTATGCGGATACGATGGCCACGCTCTTGGCTTTATTGTCACATCCA
GAGGAACTCTTCGGGACTTCTGGGGACCCAGGATCGAAGACTGCTGCGAAATCCATTGTGATCTTGTTGGATGAG
TTCGACCTATTCGTCACTCACCCACGACAGACTTTGTTGTATAATCTGTTCGATATTGCCCAAGCCCGCAAAGCC
CCCATCACGGTGATTGGGCTCACGACAAAGGTCGACGTAACCGAAATGCTCGAGAAGCGTGTCAAGAGTCGATTT
AGTCATCGTTATACTTACGTTCCTCTACCTCGATCCTTCGAGGCCTTTTCAGATATCTGCCTAGGGAGCCTGGAT
CTCAGTGACGCCGAAATGGTTGATATTGCAGATGAACTTGGGTCTGAACGCATTCTAGTAGAGTCGAACAAGTGG
AATACACTGCTTGGGGGATGGAAGGAATATTTGAAGCATTTGTGGAATGACAACGAATTTCAATTCCACCTCAAG
CGTATCTACAACCAAACCAAATCAGCAAAGGAGTTTTTCAACAGCGCGCTTCTCCCCATCGGCGACTTGCTACAA
AGTGTGTCGACCGCCGACGCACCTATACCCGAAGTCCCAACCCCGAAAAGCTTCTCTTCCCAATCCCTTGAGTGC
CCAGACCCAGCACCTCTCCCATTCTCCACATCCATCACATCATCCAGTCCCTCGTCATTGCCACTGGCTTTGTTG
GTAGCCGCAACACGCTTGGCAGCCCTGTTCGACCCCGGAAACGACGGGTCCCAGTCACAGAGCATGGGACCACTT
GCGCTTTCATTCCCCGCCGCATACGCAGAATACGTTCGGCTCCTGACATCCGCAAAGGTATCTGCCTCGGTGTCG
GGAGCTTCTGCCACACCAGGCCGTGTCTGGGGCCGAGATGTGGCCCGAGAGTCTTGGGAAAGACTGCTCAGCTGG
GGACTCGTGACACCCGTGGGTAGTGGGAACGGCACTGCTGACGGGCAGATGTTCCGTGTGGAAATTAGTTTCGAG
GAGGTCATTGAAATGGCTGGCTCTGGGGGTGCATTGGGCCAGTGGTGGCGCGGATAG
Gene >Pro_DTO377G3_2|g994.t1
ATGCCCCGAGCATCTAAGAGGAGAAGGGTCTCCGAGGACGTTGATGGAGACATCGATATGGGAAATGATGATCAA
GACGTATTCTCCGTCCCGACATCCCCCGACAATCACGGAATTTCTCCCACACCGGTGAAAAGTGCATCGCGGCGT
CAAACTACCCGCGGAGACAACCCAGACCCCGTAACGACGGGCCAAGGCGGCGAGGTTGAGGAAGATGAAGCACAA
ACTCCCGCACGAATTGGGACACGGTCAAGTGGGCGGCAACGCAAAACACCAAAAAGGTACGACCAAGAAGCCGTA
ACACCCTCATCGAGGAGAAAACAAGCAGCCACTCCTTCGAGAAGTGCGCGTCCCACACGAAGCGCGCAAAAGCTG
CGGCAATCCCCGGTAGAAGACGAAGAAGAAGACGAACCTGAATTTAAAGAGGAAGATGATGACGATGATGACATG
GACCTCGACGAGCCGTCCCCGGAACCCGCCCCTCGTACAATTACAAGGACCAGATCGAAGAGAAGCACCGCGAAG
CCTAGATCCAAGAAAGCCTTGGTCGCAGAGCCGAAAGAGAAGTCACCTTCGCCTGGGTATCAGGACGGCTTGGAT
GACATCGATACAATACAACTCCAGCAAGACCTTTATCATGACCAGCCGGAGGCGCATGAGACTATCGATGTCTCC
GAGCCGTTGCCGGAATATGCTGGAAAATTCCAGGCGCTCTGTCAGACGGGCCTTGGGGACGAAATGCGCATTCTC
TCGACTATTCTTCTCGAAAAGCTGACAGGGAAACGACAGATTCCAGTGCGGGGACTCGAAGCTGAATACCAGAAG
GTTCATCAGCTCATTGAACAGACCGTCTCTATCGGAGAGGGCAACTCCATGCTTCTTCTTGGATCCAGGGGATGC
GGCAAGACGGCGATTGTGGAATCTATCATTTCGTCTCTTAGAAAGGAGCATTGCAATGAGTTTCACGTCGTTCGT
CTCAATGGGTTCTTGCACACAGACGACCGTCTAGCTTTGCGAGAAATGTGGCGCCAACTTGGCCGTGAGACGCAT
ACCGAGGAAGATGCGGCTAAGGTCAGTTCTTATGCGGATACGATGGCCACGCTCTTGGCTTTATTGTCACATCCA
GAGGAACTCTTCGGGACTTCTGGGGACCCAGGATCGAAGACTGCTGCGAAATCCATTGTGATCTTGTTGGATGAG
TTCGACCTATTCGTCACTCACCCACGACAGACTTTGTTGTATAATCTGTTCGATATTGCCCAAGCCCGCAAAGCC
CCCATCACGGTGATTGGGCTCACGACAAAGGTCGACGTAACCGAAATGCTCGAGAAGCGTGTCAAGAGTCGATTT
AGTCATCGTTATACTTACGTTCCTCTACCTCGATCCTTCGAGGCCTTTTCAGATATCTGCCTAGGGAGCCTGGAT
CTCAGTGACGCCGAAATGGTTGATATTGCAGATGAACTTGGGTCTGAACGCATTCTAGTAGAGTCGAACAAGTGG
AATACACTGCTTGGGGGATGGAAGGAATATTTGAAGGTAAGATCTGTATTTTCCTTTATCCAATTAATTGCATCT
TTGCTAAATCGCTGTCTTGAAAATAGCATTTGTGGAATGACAACGAATTTCAATTCCACCTCAAGCGTATCTACA
ACCAAACCAAATCAGCAAAGGAGTTTTTCAACAGCGCGCTTCTCCCCATCGGCGACTTGCTACAAAGTGTGTCGA
CCGCCGACGCACCTATACCCGAAGTCCCAACCCCGAAAAGCTTCTCTTCCCAATCCCTTGAGTGCCCAGACCCAG
CACCTCTCCCATTCTCCACATCCATCACATCATCCAGTCCCTCGTCATTGCCACTGGCTTTGTTGGTAGCCGCAA
CACGCTTGGCAGCCCTGTTCGACCCCGGAAACGACGGGTCCCAGTCACAGAGCATGGGACCACTTGCGCTTTCAT
TCCCCGCCGCATACGCAGAATACGTTCGGCTCCTGACATCCGCAAAGGTATCTGCCTCGGTGTCGGGAGCTTCTG
CCACACCAGGCCGTGTCTGGGGCCGAGATGTGGCCCGAGAGTCTTGGGAAAGACTGCTCAGCTGGGGACTCGTGA
CACCCGTGGGTAGTGGGAACGGCACTGCTGACGGGCAGATGTTCCGTGTGGAAATTAGTTTCGAGGAGGTCATTG
AAATGGCTGGCTCTGGGGGTGCATTGGGCCAGTGGTGGCGCGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail