Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g99.t1
Gene name
Locationscaffold_01:244988..246442
Strand+
Gene length (bp)1454
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00268 Ribonuc_red_sm Ribonucleotide reductase, small chain 9.5E-122 80 348

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 226 248 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g99.t1
MAAQVTPSKQAASSLENLKMSDSPIKKLDFQSTGKENAPASLKPVDAPIEKPTEKALASKPLTIKEMEATEPLLQ
ENPHRFVMFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWHNRLNDDERYFVSHVLAFFAASDGIVNENLVER
FSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCIAKKANWALRWINDRESTFAS
RLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHMNHRPDPKVVEDIIVEAVG
IEQEFLTDALPCGLLGMNAKLMCEYIEFVADRLLVALGNKKYYNATNPFDFMESISLAGKTNFFEKRVGDYQKAG
VMASTKQELNAEGEKVSNDGGLNFDEDF*
Coding >Pro_DTO377G3_2|g99.t1
ATGGCCGCTCAAGTCACTCCCTCGAAACAGGCTGCTTCCTCCCTCGAGAACCTCAAGATGAGCGATTCACCTATT
AAGAAGCTCGACTTCCAGTCGACTGGCAAAGAGAACGCGCCCGCGTCTCTGAAGCCCGTCGATGCCCCCATTGAG
AAGCCCACCGAGAAGGCTCTCGCGTCCAAGCCTCTGACCATCAAGGAGATGGAAGCGACAGAGCCCCTCCTCCAG
GAGAACCCCCACCGTTTCGTCATGTTCCCTATCAAGTACCACGAGATCTGGCAAATGTACAAGAAGGCCGAGGCT
TCTTTCTGGACCGCCGAGGAGATCGATCTTTCCAAGGATCTTCACGACTGGCACAACCGCTTGAACGACGATGAG
CGTTACTTCGTCTCCCACGTCCTCGCCTTCTTCGCCGCCTCCGACGGTATTGTCAACGAGAACCTTGTTGAGCGC
TTCAGTGGAGAGGTTCAGATCCCCGAGGCCCGTTGCTTCTACGGCTTCCAGATCATGATGGAGAACATCCACTCT
GAAACCTACTCTCTGCTCATCGATACCTACATCAAGGAGCCCAAGCAGCGTACCTACCTCTTCGATGCTATTGAC
ACTATTCCCTGCATTGCTAAGAAGGCCAACTGGGCCCTCCGCTGGATCAACGACCGTGAGTCAACCTTCGCTTCG
CGTCTGGTTGCCTTCGCCGCTGTGGAGGGTATCTTCTTCTCCGGCTCATTCGCCTCCATCTTCTGGCTGAAGAAG
CGTGGCCTAATGCCTGGTCTCACTTTCTCCAACGAGTTGATCTCCCGTGATGAGGGTCTCCACACTGACTTTGCT
TGTCTGCTGTTCTCCCACATGAACCACCGCCCCGACCCCAAGGTGGTTGAGGATATCATTGTCGAGGCTGTCGGA
ATCGAGCAGGAGTTCCTCACTGACGCTCTTCCCTGCGGCCTGCTTGGCATGAACGCCAAGCTGATGTGCGAGTAC
ATTGAGTTCGTCGCTGACCGCCTGCTGGTGGCCCTCGGCAACAAGAAGTACTACAACGCTACCAACCCCTTCGAC
TTCATGGAGTCCATCTCCTTGGCCGGCAAGACCAACTTCTTCGAAAAGCGTGTCGGTGACTACCAGAAGGCTGGT
GTCATGGCCAGCACCAAGCAGGAACTCAACGCTGAGGGCGAGAAGGTCTCAAACGACGGTGGTCTCAACTTCGAT
GAGGACTTCTAG
Transcript >Pro_DTO377G3_2|g99.t1
ATGGCCGCTCAAGTCACTCCCTCGAAACAGGCTGCTTCCTCCCTCGAGAACCTCAAGATGAGCGATTCACCTATT
AAGAAGCTCGACTTCCAGTCGACTGGCAAAGAGAACGCGCCCGCGTCTCTGAAGCCCGTCGATGCCCCCATTGAG
AAGCCCACCGAGAAGGCTCTCGCGTCCAAGCCTCTGACCATCAAGGAGATGGAAGCGACAGAGCCCCTCCTCCAG
GAGAACCCCCACCGTTTCGTCATGTTCCCTATCAAGTACCACGAGATCTGGCAAATGTACAAGAAGGCCGAGGCT
TCTTTCTGGACCGCCGAGGAGATCGATCTTTCCAAGGATCTTCACGACTGGCACAACCGCTTGAACGACGATGAG
CGTTACTTCGTCTCCCACGTCCTCGCCTTCTTCGCCGCCTCCGACGGTATTGTCAACGAGAACCTTGTTGAGCGC
TTCAGTGGAGAGGTTCAGATCCCCGAGGCCCGTTGCTTCTACGGCTTCCAGATCATGATGGAGAACATCCACTCT
GAAACCTACTCTCTGCTCATCGATACCTACATCAAGGAGCCCAAGCAGCGTACCTACCTCTTCGATGCTATTGAC
ACTATTCCCTGCATTGCTAAGAAGGCCAACTGGGCCCTCCGCTGGATCAACGACCGTGAGTCAACCTTCGCTTCG
CGTCTGGTTGCCTTCGCCGCTGTGGAGGGTATCTTCTTCTCCGGCTCATTCGCCTCCATCTTCTGGCTGAAGAAG
CGTGGCCTAATGCCTGGTCTCACTTTCTCCAACGAGTTGATCTCCCGTGATGAGGGTCTCCACACTGACTTTGCT
TGTCTGCTGTTCTCCCACATGAACCACCGCCCCGACCCCAAGGTGGTTGAGGATATCATTGTCGAGGCTGTCGGA
ATCGAGCAGGAGTTCCTCACTGACGCTCTTCCCTGCGGCCTGCTTGGCATGAACGCCAAGCTGATGTGCGAGTAC
ATTGAGTTCGTCGCTGACCGCCTGCTGGTGGCCCTCGGCAACAAGAAGTACTACAACGCTACCAACCCCTTCGAC
TTCATGGAGTCCATCTCCTTGGCCGGCAAGACCAACTTCTTCGAAAAGCGTGTCGGTGACTACCAGAAGGCTGGT
GTCATGGCCAGCACCAAGCAGGAACTCAACGCTGAGGGCGAGAAGGTCTCAAACGACGGTGGTCTCAACTTCGAT
GAGGACTTCTAG
Gene >Pro_DTO377G3_2|g99.t1
ATGGCCGCTCAAGTCACTCCCTCGAAACAGGTACGTGATGTCACGTCTCTTGCCTCTCGCCTCTCGCGTCCGACG
CGTCGTGAAGTTCGTTTGAGCTAACATTTACTTTTTCTTAGGCTGCTTCCTCCCTCGAGAACCTCAAGATGAGCG
ATTCACCTATTAAGAAGCTCGACTTCCAGTCGACTGGCAAAGAGAACGCGCCCGCGTCTCTGAAGCCCGTCGATG
CCCCCATTGAGAAGCCCACCGAGAAGGCTCTCGCGTCCAAGCCTCTGACCATCAAGGAGATGGAAGCGACAGAGC
CCCTCCTCCAGGAGAACCCCCACCGTTTCGTCATGTTCCCTATCAAGTACCACGAGGTAAGTCACGTCGTCGACG
CGTCCCACGCGTAAAGTGGATATCGACAAAGATGTTCTGCCACTGTGAACATTGAAGCTAACCGTATCCCTCATT
TCACAGATCTGGCAAATGTACAAGAAGGCCGAGGCTTCTTTCTGGACCGCCGAGGAGATCGATCTTTCCAAGGAT
CTTCACGACTGGCACAACCGCTTGAACGACGATGAGCGTTACTTCGTCTCCCACGTCCTCGCCTTCTTCGCCGCC
TCCGACGGTATTGTCAACGAGAACCTTGTTGAGCGCTTCAGTGGAGAGGTTCAGATCCCCGAGGCCCGTTGCTTC
TACGGCTTCCAGATCATGATGGAGAACATCCACTCTGAAACCTACTCTCTGCTCATCGATACCTACATCAAGGAG
CCCAAGCAGCGTACCTACCTCTTCGATGCTATTGACACTAGTGAGTGATTCTCCCATTGACTTGATATTTGTCCA
ATTGTCTAACCTGGCACTTAGTTCCCTGCATTGCTAAGAAGGCCAACTGGGCCCTCCGCTGGATCAACGACCGTG
AGTCAACCTTCGCTTCGCGTCTGGTTGCCTTCGCCGCTGTGGAGGGTATCTTCTTCTCCGGCTCATTCGCCTCCA
TCTTCTGGCTGAAGAAGCGTGGCCTAATGCCTGGTCTCACTTTCTCCAACGAGTTGATCTCCCGTGATGAGGGTC
TCCACACTGACTTTGCTTGTCTGCTGTTCTCCCACATGAACCACCGCCCCGACCCCAAGGTGGTTGAGGATATCA
TTGTCGAGGCTGTCGGAATCGAGCAGGAGTTCCTCACTGACGCTCTTCCCTGCGGCCTGCTTGGCATGAACGCCA
AGCTGATGTGCGAGTACATTGAGTTCGTCGCTGACCGCCTGCTGGTGGCCCTCGGCAACAAGAAGTACTACAACG
CTACCAACCCCTTCGACTTCATGGAGTCCATCTCCTTGGCCGGCAAGACCAACTTCTTCGAAAAGCGTGTCGGTG
ACTACCAGAAGGCTGGTGTCATGGCCAGCACCAAGCAGGAACTCAACGCTGAGGGCGAGAAGGTCTCAAACGACG
GTGGTCTCAACTTCGATGAGGACTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail