Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g987.t1
Gene name
Locationscaffold_01:2621856..2623375
Strand-
Gene length (bp)1519
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00953 Glycos_transf_4 Glycosyl transferase family 4 1.1E-33 148 321

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008963 phospho-N-acetylmuramoyl-pentapeptide-transferase activity Yes
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 37 59 22
3 80 102 22
4 141 160 19
5 173 192 19
6 212 234 22
7 241 259 18
8 274 296 22
9 309 331 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 35.84 20.18 51.50
5d_25C Five days - 25 degrees Celsius 24.57 12.87 36.28
7d_25C Seven days - 25 degrees Celsius 24.17 12.59 35.75
10d_25C Ten days - 25 degrees Celsius 23.57 12.25 34.88
7d_15C Seven days - 15 degrees Celsius 30.72 16.60 44.84
7d_30C Seven days - 30 degrees Celsius 20.97 10.44 31.50

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.147337 no
3d_25C 7d_25C 0.126810 no
3d_25C 7d_15C 0.628280 no
3d_25C 7d_30C 0.031312 yes
3d_25C 10d_25C 0.097583 no
5d_25C 7d_25C 0.968055 no
5d_25C 7d_15C 0.466411 no
5d_25C 7d_30C 0.642976 no
5d_25C 10d_25C 0.916243 no
7d_25C 7d_15C 0.425906 no
7d_25C 7d_30C 0.686838 no
7d_25C 10d_25C 0.952490 no
7d_15C 7d_30C 0.165132 no
7d_15C 10d_25C 0.349761 no
7d_30C 10d_25C 0.744854 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g987.t1
MNNPSTLSRKETWRLLALVGAGLAILNATFQGDGAPLVASIALCGIVFAVAFSLIRWLGPVFLKAGLKGKDMAKP
SRPEIPETMGAVCAVVYLMALIMFIPFAFYKDIVAATSGGGNRDVVVPSQHIENGRFLHRFPHGKLASYLSGLLS
LQSVVILGIGDDLFDIRWRHKVLIPAFSAIPMLIVYFVDFGVTQVVVPVPLQPYLGDVVDLGWLYYMYMAAVAIF
CPNAINMLAGINGIEVAQSLVIAIQLLFNDAMYLAPMTPYPHPATDSHLLSMYFLLPFIGVSAALLCHNWYPSKV
FVGDTYCYFAGMVFAVVGILGHFSKTLLLLFIPQIFNFLYSTPQLFHLIPCPRHRLPKFHASTGLLDASVTEWTS
PPSHFIDTVLRLLHTLKLVRITQDENGRITESSNLTILNLWLVWVGPMREDQLAWHMVAVQTACGMLGLFVRHRL
ALLVFHHDNREFGFIA*
Coding >Pro_DTO377G3_2|g987.t1
ATGAATAACCCAAGCACCCTCTCCCGTAAGGAGACTTGGCGTCTACTGGCACTCGTGGGGGCCGGTTTAGCCATA
CTCAACGCCACGTTCCAAGGCGATGGGGCGCCTTTAGTCGCTTCAATTGCACTATGTGGCATAGTATTTGCTGTG
GCTTTTAGTCTGATCAGGTGGCTCGGCCCTGTATTTTTGAAAGCAGGACTTAAAGGCAAGGATATGGCAAAGCCT
AGCCGGCCCGAGATACCTGAAACTATGGGTGCAGTCTGCGCAGTTGTGTATCTGATGGCGCTCATTATGTTCATT
CCTTTTGCCTTCTACAAGGATATCGTTGCAGCCACATCCGGAGGCGGAAACCGTGACGTTGTGGTTCCATCGCAA
CATATTGAGAATGGCCGATTTCTTCATCGATTTCCACATGGCAAGCTCGCCTCCTACCTTTCTGGTCTTCTGTCT
TTGCAATCCGTTGTGATTCTCGGAATCGGTGATGATCTATTCGACATTCGCTGGAGACACAAAGTCCTCATCCCT
GCTTTTTCCGCAATCCCCATGCTCATTGTGTACTTTGTCGACTTTGGCGTCACTCAAGTCGTCGTGCCGGTGCCG
CTGCAACCTTACCTGGGTGATGTTGTCGATCTTGGATGGCTGTACTACATGTATATGGCAGCGGTGGCAATCTTC
TGTCCAAACGCGATCAACATGTTGGCAGGCATTAATGGTATCGAGGTAGCTCAGTCACTGGTGATTGCGATCCAA
TTGCTATTCAATGATGCGATGTACCTTGCACCTATGACACCATACCCGCACCCTGCCACCGACTCGCACTTATTG
TCGATGTACTTCCTGCTTCCATTCATCGGTGTGTCGGCAGCCCTTCTATGCCATAATTGGTATCCGTCGAAGGTG
TTTGTGGGCGATACATACTGCTATTTCGCAGGAATGGTGTTTGCCGTGGTTGGTATCCTAGGGCATTTCAGCAAA
ACCCTGTTACTACTGTTCATTCCACAGATCTTCAATTTCCTTTACTCCACTCCCCAACTATTCCATCTCATTCCT
TGTCCTCGTCATCGGTTACCAAAGTTCCACGCTTCCACTGGGTTGCTGGACGCTTCAGTCACGGAGTGGACGAGT
CCTCCTTCGCACTTCATCGATACCGTACTACGCTTATTACACACCTTGAAACTGGTGCGAATCACCCAAGACGAG
AATGGTCGAATCACTGAATCCAGTAATCTCACCATCTTGAATCTTTGGCTGGTGTGGGTGGGTCCAATGCGAGAA
GACCAACTGGCGTGGCACATGGTTGCAGTACAAACTGCCTGTGGGATGCTCGGTCTGTTCGTCAGACATCGCCTT
GCATTGCTCGTGTTCCACCATGATAATAGGGAGTTCGGTTTTATCGCATAG
Transcript >Pro_DTO377G3_2|g987.t1
ATGAATAACCCAAGCACCCTCTCCCGTAAGGAGACTTGGCGTCTACTGGCACTCGTGGGGGCCGGTTTAGCCATA
CTCAACGCCACGTTCCAAGGCGATGGGGCGCCTTTAGTCGCTTCAATTGCACTATGTGGCATAGTATTTGCTGTG
GCTTTTAGTCTGATCAGGTGGCTCGGCCCTGTATTTTTGAAAGCAGGACTTAAAGGCAAGGATATGGCAAAGCCT
AGCCGGCCCGAGATACCTGAAACTATGGGTGCAGTCTGCGCAGTTGTGTATCTGATGGCGCTCATTATGTTCATT
CCTTTTGCCTTCTACAAGGATATCGTTGCAGCCACATCCGGAGGCGGAAACCGTGACGTTGTGGTTCCATCGCAA
CATATTGAGAATGGCCGATTTCTTCATCGATTTCCACATGGCAAGCTCGCCTCCTACCTTTCTGGTCTTCTGTCT
TTGCAATCCGTTGTGATTCTCGGAATCGGTGATGATCTATTCGACATTCGCTGGAGACACAAAGTCCTCATCCCT
GCTTTTTCCGCAATCCCCATGCTCATTGTGTACTTTGTCGACTTTGGCGTCACTCAAGTCGTCGTGCCGGTGCCG
CTGCAACCTTACCTGGGTGATGTTGTCGATCTTGGATGGCTGTACTACATGTATATGGCAGCGGTGGCAATCTTC
TGTCCAAACGCGATCAACATGTTGGCAGGCATTAATGGTATCGAGGTAGCTCAGTCACTGGTGATTGCGATCCAA
TTGCTATTCAATGATGCGATGTACCTTGCACCTATGACACCATACCCGCACCCTGCCACCGACTCGCACTTATTG
TCGATGTACTTCCTGCTTCCATTCATCGGTGTGTCGGCAGCCCTTCTATGCCATAATTGGTATCCGTCGAAGGTG
TTTGTGGGCGATACATACTGCTATTTCGCAGGAATGGTGTTTGCCGTGGTTGGTATCCTAGGGCATTTCAGCAAA
ACCCTGTTACTACTGTTCATTCCACAGATCTTCAATTTCCTTTACTCCACTCCCCAACTATTCCATCTCATTCCT
TGTCCTCGTCATCGGTTACCAAAGTTCCACGCTTCCACTGGGTTGCTGGACGCTTCAGTCACGGAGTGGACGAGT
CCTCCTTCGCACTTCATCGATACCGTACTACGCTTATTACACACCTTGAAACTGGTGCGAATCACCCAAGACGAG
AATGGTCGAATCACTGAATCCAGTAATCTCACCATCTTGAATCTTTGGCTGGTGTGGGTGGGTCCAATGCGAGAA
GACCAACTGGCGTGGCACATGGTTGCAGTACAAACTGCCTGTGGGATGCTCGGTCTGTTCGTCAGACATCGCCTT
GCATTGCTCGTGTTCCACCATGATAATAGGGAGTTCGGTTTTATCGCATAG
Gene >Pro_DTO377G3_2|g987.t1
ATGAATAACCCAAGCACCCTCTCCCGTAAGGAGACTTGGCGTCTACTGGCACTCGTGGGGGCCGGTTTAGCCATA
CTCAACGCCACGTTCCAAGGCGATGGGGCGCCTTTAGTCGCTTCAATTGCACTATGTGGCATAGTATTTGCTGTG
GCTTTTAGTCTGATCAGGTGGCTCGGCCCTGTATTTTTGAAAGCAGGACTTAAAGGCAAGGATATGGCAAAGCCT
AGCCGGCCCGAGATGTATGTATATGGCTCTTGAACTTGAGATCATATTCATAGCATGTACTAATATCTTGTTCTA
GACCTGAAACTATGGGTGCAGTCTGCGCAGTTGTGTATCTGATGGCGCTCATTATGTTCATTCCTTTTGCCTTCT
ACAAGGATATCGTTGCAGCCACATCCGGAGGCGGAAACCGTGACGTTGTGGTTCCATCGCAACATATTGAGAATG
GCCGATTTCTTCATCGATTTCCACATGGCAAGGTGAGTTCTGATTTCAATTGACTGAGGCATACCCAATTTAATG
TGCAATTGAATAGCTCGCCTCCTACCTTTCTGGTCTTCTGTCTTTGCAATCCGTTGTGATTCTCGGAATCGGTGA
TGATCTATTCGACATTCGCTGGAGACACAAAGTCCTCATCCCTGCTTTTTCCGCAATCCCCATGCTCATTGTGTA
CTTTGTCGACTTTGGCGTCACTCAAGTCGTCGTGCCGGTGCCGCTGCAACCTTACCTGGGTGATGTTGTCGATCT
TGGATGGCTGTACTACATGTATATGGCAGCGGTGGCAATCTTCTGTCCAAACGCGATCAACATGTTGGCAGGCAT
TAATGGTATCGAGGTAGCTCAGTCACTGGTGATTGCGATCCAATTGCTATTCAATGATGCGATGTACCTTGCACC
TATGACACCATACCCGCACCCTGCCACCGACTCGCACTTATTGTCGATGTACTTCCTGCTTCCATTCATCGGTGT
GTCGGCAGCCCTTCTATGCCATAATTGGTATCCGTCGAAGGTGTTTGTGGGCGATACATACTGCTATTTCGCAGG
AATGGTGTTTGCCGTGGTTGGTATCCTAGGGCATTTCAGCAAAACCCTGTTACTACTGTTCATTCCACAGATCTT
CAATTTCCTTTACTCCACTCCCCAACTATTCCATCTCATTCCTTGTCCTCGTCATCGGTTACCAAAGTTCCACGC
TTCCACTGGGTTGCTGGACGCTTCAGTCACGGAGTGGACGAGTCCTCCTTCGCACTTCATCGATACCGTACTACG
CTTATTACACACCTTGAAACTGGTGCGAATCACCCAAGACGAGAATGGTCGAATCACTGAATCCAGTAATCTCAC
CATCTTGAATCTTTGGCTGGTGTGGGTGGGTCCAATGCGAGAAGACCAACTGGCGTGGCACATGGTTGCAGTACA
AACTGCCTGTGGGATGCTCGGTCTGTTCGTCAGACATCGCCTTGCATTGCTCGTGTTCCACCATGATAATAGGGA
GTTCGGTTTTATCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail