Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g986.t1
Gene name
Locationscaffold_01:2620109..2621684
Strand+
Gene length (bp)1575
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05978 UNC-93 Ion channel regulatory protein UNC-93 9.0E-08 74 147

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 37 56 19
2 71 93 22
3 100 117 17
4 127 149 22
5 162 184 22
6 194 216 22
7 254 274 20
8 284 306 22
9 319 338 19
10 358 380 22
11 420 442 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g986.t1
MTNSEKEAVPSEKVDSAGSITSPVGGPHKVKWYRSTFYNAFILGLCNFLAPGIWGAMNSLGGGGEEKPYLVNAAN
ALTFGLMVVSCFFSSVLVRFIGIKWALIVGTMGYAPYAAGLYTNNRFGVEWLVLLGAALCGISAGIFWMAEAAIA
LSYPEPYNQGRFLGFWLSFRVGGQILGGAINLGINANRSNSGSVSYTVYLIFIALQALGPFAGLLLSNPSQVQRK
DGVPVNLQVTKSITHELKSMWKLWINRKFLYIIPFICQAVYTEAVMFSYEGLWFSVRARALGSFLSGVVAVTIGN
ILGAFLDSKRVSLKNRTRYAFYFVVAWQGMCWIWATVVTTEFNETHPTYDWSTPGFGRAFALFLFWVAGFQLNYM
YLFFLVGNLADDQEEVVRIAGLLRGTESAAQCVSYGLSSVNIMAAVGSIYLNFGLWAIAIIPTWIIIKDIGTAFE
DKKIARETPGLREAVDQE*
Coding >Pro_DTO377G3_2|g986.t1
ATGACGAACTCAGAAAAGGAAGCTGTCCCGAGTGAGAAGGTGGACAGTGCAGGTTCTATCACCTCGCCCGTTGGT
GGGCCACATAAAGTCAAGTGGTACCGATCGACATTCTACAATGCCTTCATCCTCGGTCTTTGCAACTTCCTCGCC
CCTGGAATCTGGGGCGCCATGAACTCTTTGGGTGGAGGAGGTGAAGAGAAACCTTACCTCGTCAACGCAGCGAAC
GCCTTGACCTTCGGTCTTATGGTCGTCTCTTGCTTCTTCAGCAGTGTCCTCGTACGATTCATCGGCATCAAATGG
GCACTCATCGTCGGAACAATGGGATACGCACCTTACGCAGCGGGGCTGTACACAAACAACCGATTTGGCGTCGAA
TGGCTGGTTCTCCTGGGCGCGGCACTTTGCGGCATCTCGGCCGGTATTTTCTGGATGGCAGAGGCAGCAATTGCA
CTTTCGTACCCCGAGCCATACAACCAAGGCCGCTTCCTGGGATTCTGGCTCAGCTTCCGTGTTGGAGGACAAATC
CTCGGCGGTGCCATCAACCTGGGCATCAATGCCAATCGGTCGAACTCGGGCTCTGTCTCATACACTGTGTACCTG
ATTTTCATTGCGCTGCAGGCACTCGGCCCCTTTGCTGGTCTGCTGTTGAGCAATCCCTCTCAGGTCCAGCGAAAA
GACGGAGTCCCTGTTAACCTGCAGGTGACAAAAAGTATCACACATGAGCTGAAGAGCATGTGGAAGCTTTGGATC
AATCGCAAGTTCCTGTACATCATTCCGTTCATCTGCCAGGCTGTGTACACAGAGGCTGTGATGTTCTCATACGAG
GGATTGTGGTTCTCGGTGCGAGCCAGAGCCCTCGGGTCATTCCTTTCCGGTGTGGTCGCTGTAACCATCGGCAAC
ATTCTCGGAGCCTTCCTTGACAGCAAGCGGGTATCCCTGAAAAACAGAACTCGATACGCGTTTTACTTCGTTGTC
GCATGGCAAGGCATGTGCTGGATCTGGGCTACAGTGGTGACAACCGAGTTTAACGAAACACACCCGACATATGAC
TGGTCTACTCCAGGCTTCGGGAGAGCCTTCGCCCTCTTCCTGTTCTGGGTTGCTGGCTTCCAGCTCAACTATATG
TACCTGTTTTTCTTGGTGGGCAACCTTGCCGATGATCAAGAAGAAGTCGTCCGGATTGCGGGCTTGTTGCGTGGA
ACTGAATCCGCAGCTCAGTGTGTCAGCTACGGTCTAAGCAGCGTGAACATCATGGCCGCGGTGGGGAGTATTTAT
CTCAACTTTGGCTTGTGGGCTATCGCGATAATCCCTACCTGGATCATTATCAAAGACATCGGAACAGCCTTTGAG
GATAAAAAGATCGCTAGAGAGACTCCTGGTTTGCGCGAGGCCGTCGATCAGGAGTAA
Transcript >Pro_DTO377G3_2|g986.t1
ATGACGAACTCAGAAAAGGAAGCTGTCCCGAGTGAGAAGGTGGACAGTGCAGGTTCTATCACCTCGCCCGTTGGT
GGGCCACATAAAGTCAAGTGGTACCGATCGACATTCTACAATGCCTTCATCCTCGGTCTTTGCAACTTCCTCGCC
CCTGGAATCTGGGGCGCCATGAACTCTTTGGGTGGAGGAGGTGAAGAGAAACCTTACCTCGTCAACGCAGCGAAC
GCCTTGACCTTCGGTCTTATGGTCGTCTCTTGCTTCTTCAGCAGTGTCCTCGTACGATTCATCGGCATCAAATGG
GCACTCATCGTCGGAACAATGGGATACGCACCTTACGCAGCGGGGCTGTACACAAACAACCGATTTGGCGTCGAA
TGGCTGGTTCTCCTGGGCGCGGCACTTTGCGGCATCTCGGCCGGTATTTTCTGGATGGCAGAGGCAGCAATTGCA
CTTTCGTACCCCGAGCCATACAACCAAGGCCGCTTCCTGGGATTCTGGCTCAGCTTCCGTGTTGGAGGACAAATC
CTCGGCGGTGCCATCAACCTGGGCATCAATGCCAATCGGTCGAACTCGGGCTCTGTCTCATACACTGTGTACCTG
ATTTTCATTGCGCTGCAGGCACTCGGCCCCTTTGCTGGTCTGCTGTTGAGCAATCCCTCTCAGGTCCAGCGAAAA
GACGGAGTCCCTGTTAACCTGCAGGTGACAAAAAGTATCACACATGAGCTGAAGAGCATGTGGAAGCTTTGGATC
AATCGCAAGTTCCTGTACATCATTCCGTTCATCTGCCAGGCTGTGTACACAGAGGCTGTGATGTTCTCATACGAG
GGATTGTGGTTCTCGGTGCGAGCCAGAGCCCTCGGGTCATTCCTTTCCGGTGTGGTCGCTGTAACCATCGGCAAC
ATTCTCGGAGCCTTCCTTGACAGCAAGCGGGTATCCCTGAAAAACAGAACTCGATACGCGTTTTACTTCGTTGTC
GCATGGCAAGGCATGTGCTGGATCTGGGCTACAGTGGTGACAACCGAGTTTAACGAAACACACCCGACATATGAC
TGGTCTACTCCAGGCTTCGGGAGAGCCTTCGCCCTCTTCCTGTTCTGGGTTGCTGGCTTCCAGCTCAACTATATG
TACCTGTTTTTCTTGGTGGGCAACCTTGCCGATGATCAAGAAGAAGTCGTCCGGATTGCGGGCTTGTTGCGTGGA
ACTGAATCCGCAGCTCAGTGTGTCAGCTACGGTCTAAGCAGCGTGAACATCATGGCCGCGGTGGGGAGTATTTAT
CTCAACTTTGGCTTGTGGGCTATCGCGATAATCCCTACCTGGATCATTATCAAAGACATCGGAACAGCCTTTGAG
GATAAAAAGATCGCTAGAGAGACTCCTGGTTTGCGCGAGGCCGTCGATCAGGAGTAA
Gene >Pro_DTO377G3_2|g986.t1
ATGACGAACTCAGAAAAGGAAGCTGTCCCGAGTGAGAAGGTGGACAGTGCAGGTTCTATCACCTCGCCCGTTGGT
GGGCCACATAAAGGTGAGTTTGGAACAATGTTCCTGTCCAACGTCGATGAAGCTGACTTTGACCCTGATAGTCAA
GTGGTACCGATCGACATTCTACAATGCCTTCATCCTCGGTCTTTGCAACTTCCTCGCCCCTGGAATCTGGGGCGC
CATGAACTCTTTGGGTGGAGGAGGTGAAGAGAAACCTTACCTCGTCAACGCAGCGAACGCCTTGACCTTCGGTCT
TATGGTCGTCTCTTGCTTCTTCAGCAGTGTCCTCGTACGATTCATCGGCATCAAATGGGCACTCATCGTCGGAAC
AATGGGATACGCACCTTACGCAGCGGGGCTGTACACAAACAACCGATTTGGCGTCGAATGGCTGGTTCTCCTGGG
CGCGGCACTTTGCGGCATCTCGGCCGGTATTTTCTGGATGGCAGAGGCAGCAATTGCACTTTCGTACCCCGAGCC
ATACAACCAAGGCCGCTTCCTGGGATTCTGGCTCAGCTTCCGTGTTGGAGGACAAATCCTCGGCGGTGCCATCAA
CCTGGGCATCAATGCCAATCGGTCGAACTCGGGCTCTGTCTCATACACTGTGTACCTGATTTTCATTGCGCTGCA
GGCACTCGGCCCCTTTGCTGGTCTGCTGTTGAGCAATCCCTCTCAGGTCCAGCGAAAAGACGGAGTCCCTGTTAA
CCTGCAGGTGACAAAAAGTATCACACATGAGCTGAAGAGCATGTGGAAGCTTTGGATCAATCGCAAGTTCCTGTA
CATCATTCCGTTCATCTGCCAGGCTGTGTACACAGAGGCTGTGATGTTCTCATACGAGGGATTGTGGTTCTCGGT
GCGAGCCAGAGCCCTCGGGTCATTCCTTTCCGGTGTGGTCGCTGTAACCATCGGCAACATTCTCGGAGCCTTCCT
TGACAGCAAGCGGGTATCCCTGAAAAACAGAACTCGATACGCGTTTTACTTCGTTGTCGCATGGCAAGGCATGTG
CTGGATCTGGGCTACAGTGGTGACAACCGAGTTTAACGAAACACACCCGACATATGACTGGTCTACTCCAGGCTT
CGGGAGAGCCTTCGCCCTCTTCCTGTTCTGGGTTGCTGGCTTCCAGCTCAACTATATGTACCTGTAAGTTGAATC
TCCATTGGTGACTATTCAGTCCATGTTACTAACTGATCAGGTTTTTCTTGGTGGGCAACCTTGCCGATGATCAAG
AAGAAGTCGTCCGGATTGCGGGCTTGTTGCGTGGAACTGAATCCGCAGCTCAGTGTGTCAGCGTACGTACACCTC
TTATCTCGCTTCCGTGCAACATGAATACTAACGAGCTATCTCTAGTACGGTCTAAGCAGCGTGAACATCATGGCC
GCGGTGGGGAGTATTTATCTCAACTTTGGCTTGTGGGCTATCGCGATAATCCCTACCTGGATCATTATCAAAGAC
ATCGGAACAGCCTTTGAGGATAAAAAGATCGCTAGAGAGACTCCTGGTTTGCGCGAGGCCGTCGATCAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail