Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g983.t1
Gene name
Locationscaffold_01:2605367..2612926
Strand+
Gene length (bp)7559
Transcript length (bp)7248
Coding sequence length (bp)7248
Protein length (aa) 2416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 6.3E-16 99 357
PF08323 Glyco_transf_5 Starch synthase catalytic domain 1.0E-13 1160 1332

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 1071 1093 22
2 1990 2012 22
3 2025 2042 17
4 2047 2069 22
5 2079 2101 22
6 2114 2136 22
7 2160 2182 22
8 2206 2225 19
9 2240 2262 22
10 2269 2291 22
11 2313 2335 22
12 2342 2364 22
13 2384 2406 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g983.t1
MNWRYKIPVLALLAAPGISWPYDETLTDYNINENQTATNPLDYWGEWPDHTYFPSPENWRFPVYTLFLDRFVNGD
PTNDNINGTLFEHDINSNQMRHGGDVAGLLDTLDYLQGMGIKGLYLAGLVLMNQPWGSDGYSALDTTLLDQHFGT
IKTWRTAITEIHKRGMYVIFDNTVSTMGDLIGFEGYMNTTTPFSVKEHKAAWKSDRQYVDFRYGNTYNETCEYPR
FWNETGYPVDEYVNYELGGCYDSDFDQYGDIEAFGVYPDWKRELAKFASVQDRLREWVSSVKKRIIRHSCMIIAS
FDIDGFRYDKATQATVDALGDISEAYRGCARRVGKDNFFLPGEITSGNTLGSIFHGRGRQPDMKSQTLDQAFMMT
NASDPDYFIRDHNKQATDAAAFHYSVYRSLTRFLGMDGNLAAGYDVPVNWTEAWYQMVLTNDMINANTGKFDPRH
MYGATNQDVFRWPTVEYGVERQLLALFITTLHMPGIPMLLWGEEQAFYILDASAANYIYGRQAMSPATAWKIHGC
FQLNSTQYFQWPIKSGRLGCYDETVTYDHRDPAHPVRNIIKHMYQMRQDFGALNDGWWIQLLSNQTRNIYLPGSD
GVATETGMWSVLRSPYYQLQDLGEMGNQTVWFVYQNDNRTVNYEFDCSNQTAALIAPFGTNSTVKNLFYPHDELT
LQEGPVKLGLNGSDDYNGCLDSMRLRPYEFRAYIRKERFVFPRPMITKFIPGHDTPLLSAVAPDESESVDISLFF
STEMNCSMVTESISLESSTETGERPSLDLASVNCGSVEPEITSWTGQIPSTWSWTGTLTGVYNGVHKLTVNNATT
PDGRATNAVDHFLFRVGQSDNPMIFTTANYSSSLLHSRDDGTLFIAQHAAGADKYRYSTNWGSTFTEWLPYVGGN
HTIEELPWSGTKKQGWDGKHVRVEYWSRLTGSSDYIQEGDGPGWSPAIRRRFPHLFFNGPFNRYGYDAGLDNVVR
QDTDGLWKFRFMTEWPAQGQLNVWGINPDNQPDQSYIYGDSDGDSILDRLPPSSLSVTSINITRHPPSPHLAWRI
QLDDSNLQFKLVPTGSKYVQMALFILLCIVPVITASTCAYVFMKTFYRIKFNQVGVSEKKTLISMDFINKFEVGH
VEDGQSRNPFRRLTSRSNFLQSTSAFGNRTAHRRKVLIATMEYEIDDWAIKIKIGGLGVMAQLMGKQLGHQDLIW
VIPCVGGVKYPVDKQADSMFVMILGNSYEIKIQYHQLRNITYVLLDAPVFRQQSVIEPYPARMDDLDSAIYYSAW
NQCIAQAMKRFPVDLYHINDYHGSVAPLYLLPETIPICLSLHNAEFQGLWPMRTQKERTEVCSVFNLDLDIVTRY
VQFGEIFNLLHAGASYLRLHQQGFGAVGVSKKYGKRSYARYPIFWGLRKVGNLPNPDPSDTGEWDRSLPKERDIG
IDNDFEIRRAELKRQAQEWAGLKQRPDADLLVFVGRWSMQKGIDLIADVLPGVLENRENVQLICIGPLIDLYGKF
AALKLDRMTKLYPGRVCSKPQFTVLPHFIFSGADFALIPSRDEPFGLVAVEFGRKGALGIGARVGGLGQMPGWWY
TVESTTTSHLLKQFKLAIDSALNSKPEVRAMMRARSAKQRFPVVQWVDDLEILQSTSIRVHQKERTKSHSQSAAA
GAYNAIYGIMTPQTASTRSGASTPPLQPSSRPGIVGSLQRSSIIYSRDASPGFNGRPKSGLSRQISHGVQPVSGT
IEPRGRPDVGKVGVIEGDDSASGASPEAEENSDDEMMDTCYGDDDYSMPPEGVGLGRAQTPQPSLALTKEALSAQ
RTSQSSLLARCSNTPSSSTAPSTVGTDDTLIPPSRPWAEPGNRLSNASVLSVNSVVGEKKDFKLQKVDPYFTDSN
GEYYRVFEKRLEELNGANSDTQLCIEQYLEKSEKKWFNKFRDARLGLHQGSPAVSMHRGKAETSPTGSVANDDAT
SHESGERERKGAPPDEFLLGDDYVPPTGLKKWMQMRIGEWPVYSLFLGLGQIIAANSYQITLLTGEVGQTATKLY
GIATVYLITSILWWFFFRYYKSVLVLSVPWILYGTAFLIIGMAHFEPNSHNRGWIQNVGSSVYAAASSSGSIFFA
LNFGDESGAPVNQWVFRACLIQGTQQAYVIALWYWGSTLTKATNAGITDVQVSVTNTWRMTAICTPVALILWAIG
LIVYFGLPNYYRQIPGKVPSFYKSVFRRKIVLWNWVVVILQNFFLSAPYGRNWNFLWITQHASSWQILLLCVAFF
GFVWIAVLFLLARLSKSHSWILPVLACGLGAPRWAQIWWGTSGSGLFLPWAGSYTSGALISRSLWLWLGVLDALQ
GLGFGMILLQTLTRMHICFTLLVSQVLGSLATICARAFAPNNIGPGPISPDITAGAGALGNAWFWVALLLQLSIC
GGFLLFFRREQLSKP*
Coding >Pro_DTO377G3_2|g983.t1
ATGAATTGGAGATATAAAATCCCAGTCCTTGCTCTTCTCGCAGCTCCAGGAATCAGTTGGCCCTACGACGAGACT
CTCACTGATTATAACATCAACGAAAACCAAACAGCGACCAACCCCTTAGACTACTGGGGAGAATGGCCCGACCAC
ACCTACTTTCCTTCTCCAGAAAATTGGCGCTTTCCTGTATATACGCTTTTCCTTGACCGATTTGTGAACGGTGAT
CCAACAAACGACAATATAAATGGGACACTCTTTGAACATGATATCAATTCAAACCAAATGCGACACGGAGGTGAC
GTGGCTGGTTTGCTGGACACTTTGGACTATTTGCAAGGAATGGGCATCAAGGGACTTTATCTTGCAGGTTTGGTA
TTGATGAACCAGCCATGGGGGTCTGATGGTTACTCAGCGCTTGACACGACTCTACTCGACCAGCATTTTGGGACA
ATTAAAACATGGAGAACAGCTATAACGGAGATTCACAAGCGCGGCATGTACGTTATTTTTGACAATACGGTCTCA
ACCATGGGAGATCTCATTGGATTTGAAGGGTATATGAATACAACTACACCATTTTCGGTCAAAGAGCACAAGGCC
GCCTGGAAATCGGACCGTCAATATGTTGATTTTCGATATGGCAACACCTACAATGAGACATGTGAATATCCTCGC
TTCTGGAATGAGACCGGGTACCCCGTGGACGAGTACGTTAATTATGAGCTAGGCGGGTGCTACGACAGTGATTTT
GATCAATATGGCGATATCGAGGCCTTTGGTGTCTATCCCGACTGGAAACGAGAGCTCGCTAAATTTGCATCGGTG
CAAGACCGGCTGCGCGAATGGGTGTCTAGTGTCAAAAAGAGAATTATTCGTCATTCGTGTATGATCATCGCTTCT
TTCGACATCGACGGCTTTCGCTATGACAAAGCTACGCAAGCTACTGTCGATGCCCTTGGGGATATTTCTGAGGCG
TATCGAGGCTGTGCTCGCCGTGTGGGAAAAGACAATTTCTTCCTTCCGGGTGAGATTACAAGTGGAAATACTCTT
GGCTCTATCTTTCATGGGCGAGGACGTCAGCCTGATATGAAGTCCCAGACGCTTGATCAAGCCTTTATGATGACG
AATGCCTCTGATCCGGATTACTTTATCCGTGACCACAACAAGCAGGCGACTGATGCTGCCGCTTTTCATTACTCC
GTTTATCGCTCCCTCACCCGGTTCTTAGGTATGGATGGCAACTTGGCTGCTGGCTACGACGTTCCAGTTAATTGG
ACCGAGGCCTGGTATCAAATGGTCCTCACCAATGACATGATAAACGCGAACACTGGCAAATTTGATCCACGCCAT
ATGTATGGAGCTACAAACCAGGATGTGTTCCGATGGCCGACCGTTGAATATGGCGTTGAAAGGCAACTTCTTGCT
CTTTTCATCACGACATTGCACATGCCCGGCATTCCTATGCTCCTATGGGGCGAGGAACAAGCGTTTTATATTTTA
GATGCTTCAGCTGCTAACTATATATATGGCCGTCAAGCAATGTCTCCCGCGACAGCTTGGAAAATCCACGGATGT
TTCCAGTTGAATTCGACTCAATATTTCCAGTGGCCTATCAAGTCGGGACGTTTGGGATGCTACGATGAGACAGTC
ACGTATGACCACCGTGATCCAGCTCACCCCGTGCGGAACATTATCAAACACATGTACCAGATGCGACAGGACTTT
GGTGCTCTCAATGACGGGTGGTGGATTCAGCTACTCTCAAACCAAACACGTAACATATATCTCCCAGGTTCTGAC
GGAGTTGCAACAGAAACTGGCATGTGGTCTGTCCTTCGCAGTCCATATTACCAATTGCAGGATTTGGGAGAAATG
GGCAATCAAACGGTCTGGTTTGTATATCAAAATGACAACCGAACGGTGAACTATGAGTTCGACTGTTCTAACCAA
ACTGCCGCATTAATTGCTCCATTCGGTACCAATAGCACGGTGAAAAACCTGTTCTATCCCCACGATGAGTTGACA
CTGCAAGAGGGTCCAGTCAAACTTGGGTTGAACGGCTCTGACGATTACAACGGTTGCCTTGACAGTATGAGGCTT
CGACCATACGAATTTAGAGCCTACATCCGAAAAGAGAGATTTGTTTTCCCTCGTCCTATGATAACCAAGTTCATA
CCTGGACATGACACTCCATTGCTATCTGCTGTCGCGCCAGATGAAAGTGAGTCAGTGGATATCAGTTTGTTCTTC
TCCACAGAGATGAATTGCTCTATGGTGACCGAGTCAATATCGCTTGAATCGTCCACCGAGACTGGAGAACGGCCT
TCTTTGGACCTTGCCAGTGTTAATTGTGGGAGTGTTGAACCGGAGATTACTTCTTGGACAGGACAAATTCCATCT
ACTTGGTCTTGGACAGGTACCCTGACTGGTGTCTACAATGGCGTGCATAAATTGACAGTGAACAACGCGACAACT
CCCGATGGGAGGGCAACTAACGCCGTCGACCATTTCTTGTTCCGAGTCGGGCAGTCTGATAACCCCATGATCTTT
ACCACGGCAAATTACTCCAGCAGCTTGCTTCACAGCCGCGATGATGGTACTCTTTTCATTGCACAACATGCAGCA
GGGGCAGATAAATATCGGTACTCTACAAATTGGGGTAGTACTTTCACTGAATGGCTACCATACGTGGGAGGAAAC
CATACCATTGAAGAACTGCCTTGGTCTGGAACAAAGAAGCAGGGATGGGATGGGAAACACGTTCGGGTTGAGTAC
TGGAGTCGCCTTACAGGTAGCAGCGACTACATCCAAGAGGGCGACGGACCGGGCTGGAGTCCTGCTATCCGACGT
CGGTTCCCTCATCTCTTTTTTAATGGACCTTTCAACAGGTACGGATATGATGCCGGCTTGGATAACGTCGTGAGG
CAAGATACCGATGGCCTATGGAAATTCCGCTTTATGACTGAATGGCCTGCCCAGGGTCAGCTGAACGTCTGGGGT
ATAAACCCCGATAATCAACCGGACCAAAGTTACATCTACGGAGATTCCGATGGAGACTCAATCCTCGACCGTCTA
CCGCCCTCTTCGCTAAGTGTGACAAGCATAAACATCACTCGGCATCCACCGAGCCCGCACCTCGCTTGGAGGATT
CAACTCGATGACTCAAATTTGCAGTTCAAGCTTGTTCCTACAGGCTCCAAATACGTTCAAATGGCTCTTTTTATC
CTTCTTTGCATTGTTCCTGTCATTACAGCGTCAACCTGCGCTTATGTGTTCATGAAAACATTCTATCGGATCAAG
TTCAACCAAGTTGGCGTGAGTGAAAAAAAGACGCTCATTTCAATGGATTTCATCAATAAATTCGAGGTAGGCCAC
GTGGAAGATGGACAGTCTAGAAACCCATTCAGACGACTTACAAGCAGGTCAAACTTCCTTCAAAGTACTTCTGCT
TTTGGTAATCGCACTGCCCACCGACGAAAAGTTCTGATTGCAACCATGGAATATGAGATCGACGACTGGGCTATC
AAGATAAAAATTGGTGGCTTGGGTGTTATGGCACAGTTAATGGGCAAACAACTCGGACATCAGGATCTTATCTGG
GTTATTCCCTGCGTGGGTGGAGTAAAGTATCCTGTCGATAAACAGGCAGATTCGATGTTTGTCATGATCTTGGGG
AATTCGTATGAAATCAAGATTCAGTACCACCAACTGAGGAACATCACATATGTTTTGCTGGATGCGCCTGTTTTT
CGCCAGCAATCCGTTATAGAGCCTTATCCAGCCCGAATGGACGACCTCGACAGCGCTATTTACTATTCTGCGTGG
AACCAATGCATTGCCCAGGCGATGAAGCGGTTTCCAGTTGATCTGTATCACATCAATGACTATCACGGCTCGGTG
GCACCGTTATATCTTTTGCCCGAGACTATTCCTATTTGCTTATCGCTCCACAACGCCGAATTTCAAGGTTTATGG
CCTATGCGAACACAGAAAGAGAGAACCGAAGTCTGTTCTGTTTTCAACCTTGATTTGGATATTGTCACACGCTAT
GTTCAGTTCGGCGAGATCTTCAATCTTCTTCATGCCGGGGCAAGCTATCTGCGCCTTCATCAACAAGGCTTTGGT
GCCGTTGGTGTGTCGAAGAAGTATGGAAAGCGGTCATATGCTCGATACCCGATCTTTTGGGGCTTGAGAAAAGTT
GGAAACCTACCGAATCCCGACCCCTCTGATACAGGCGAGTGGGATAGATCCTTACCTAAGGAGAGAGATATTGGC
ATCGACAATGACTTCGAGATCCGCAGAGCCGAGCTAAAGCGCCAAGCTCAAGAATGGGCTGGTCTTAAGCAAAGA
CCTGACGCGGATCTGTTAGTCTTCGTTGGAAGATGGTCGATGCAAAAAGGTATCGACCTGATAGCTGATGTCTTG
CCTGGTGTATTGGAGAATCGAGAAAACGTTCAGCTGATCTGCATCGGTCCCCTTATTGATTTATATGGCAAATTT
GCCGCGTTGAAACTGGATCGAATGACGAAGCTTTACCCTGGTCGAGTATGCTCTAAACCCCAGTTCACGGTATTA
CCACACTTCATCTTCTCTGGTGCAGATTTTGCACTAATTCCGTCACGCGATGAACCCTTCGGTCTTGTCGCTGTC
GAATTCGGTCGGAAGGGTGCCCTTGGGATTGGCGCCAGAGTAGGGGGACTTGGGCAGATGCCTGGCTGGTGGTAT
ACGGTTGAGTCCACGACTACCTCCCACCTATTGAAACAGTTCAAATTGGCCATCGACAGTGCATTAAACTCCAAG
CCCGAGGTGAGGGCGATGATGCGCGCAAGGTCTGCCAAGCAACGATTCCCAGTTGTCCAATGGGTCGATGATCTT
GAGATCTTACAGTCCACATCGATTCGAGTCCATCAAAAGGAACGAACCAAATCCCACAGCCAGTCCGCTGCTGCT
GGTGCATACAATGCCATCTACGGGATTATGACGCCACAAACTGCGTCAACAAGATCGGGCGCATCAACACCTCCA
TTACAACCCTCAAGTCGCCCGGGTATTGTAGGGTCACTACAGCGAAGCTCTATAATCTACAGTCGTGATGCAAGC
CCTGGATTCAATGGGAGACCTAAATCGGGACTAAGTCGCCAGATATCTCATGGTGTTCAGCCGGTATCCGGCACC
ATTGAGCCTCGTGGTCGGCCCGACGTCGGGAAAGTCGGTGTTATCGAGGGTGACGACAGCGCTAGTGGAGCCTCT
CCAGAGGCCGAAGAAAATAGCGACGATGAAATGATGGATACCTGCTATGGTGATGATGATTATTCCATGCCACCT
GAAGGAGTAGGCCTAGGTCGTGCACAAACTCCTCAACCCAGTTTGGCGCTCACCAAAGAGGCTCTCTCGGCCCAA
CGCACGAGTCAAAGCTCCTTGTTGGCTCGGTGCAGCAACACGCCCTCTAGTTCAACGGCACCGAGTACTGTCGGG
ACAGATGATACCCTTATCCCCCCTTCTCGTCCATGGGCAGAGCCAGGAAACCGTCTCAGTAATGCCTCAGTCTTG
TCTGTCAATTCGGTTGTTGGAGAGAAGAAAGACTTCAAACTTCAAAAGGTTGACCCGTACTTTACCGACAGCAAT
GGCGAGTACTACAGAGTGTTTGAAAAAAGACTCGAGGAACTGAATGGGGCGAACTCAGACACCCAACTCTGCATT
GAGCAATACCTTGAGAAAAGCGAAAAGAAATGGTTCAACAAATTCCGTGATGCACGCCTTGGCCTCCATCAAGGA
TCGCCAGCTGTCTCAATGCATCGTGGCAAAGCAGAGACATCCCCGACGGGGTCAGTTGCCAACGACGATGCGACA
TCCCATGAAAGTGGTGAGCGCGAAAGAAAAGGTGCTCCGCCTGATGAATTCCTTCTTGGTGATGACTACGTGCCA
CCAACAGGGCTGAAAAAATGGATGCAAATGCGCATCGGAGAATGGCCGGTATATTCTCTCTTCCTCGGGCTAGGT
CAGATCATTGCTGCCAATTCCTACCAGATTACCCTTCTCACTGGTGAGGTCGGTCAGACTGCTACAAAGTTGTAC
GGAATTGCGACGGTTTACCTGATTACTTCTATTCTATGGTGGTTTTTCTTCCGATACTACAAATCCGTGCTCGTT
TTGAGTGTGCCGTGGATCTTATACGGAACAGCCTTTTTGATCATCGGAATGGCACACTTTGAGCCTAACTCACAC
AATCGCGGATGGATTCAAAACGTTGGAAGTAGTGTCTATGCGGCTGCATCATCGAGCGGTTCCATCTTCTTCGCC
CTCAATTTCGGCGATGAGAGCGGTGCACCGGTCAACCAGTGGGTATTCCGTGCTTGTCTTATCCAGGGCACGCAG
CAAGCCTATGTCATTGCTCTTTGGTACTGGGGTTCAACTTTGACTAAAGCAACGAACGCGGGAATTACGGATGTG
CAGGTTAGCGTCACCAATACCTGGAGGATGACAGCAATATGTACACCAGTCGCTCTCATTTTATGGGCGATTGGC
CTTATCGTATATTTTGGCTTGCCAAACTACTATCGCCAAATTCCCGGCAAAGTGCCATCATTCTACAAATCTGTC
TTCCGGCGCAAGATTGTACTTTGGAACTGGGTGGTCGTTATTCTCCAGAACTTCTTTTTGAGTGCTCCATATGGC
CGAAACTGGAATTTCCTGTGGATTACCCAGCACGCCAGCTCGTGGCAAATCCTACTTCTCTGTGTTGCATTCTTC
GGCTTTGTCTGGATAGCAGTTCTCTTCCTGCTGGCTAGGCTATCTAAGTCCCATAGTTGGATCCTCCCGGTTCTC
GCATGTGGTCTGGGTGCACCTCGTTGGGCCCAGATCTGGTGGGGCACATCTGGGTCTGGGCTGTTCCTCCCCTGG
GCTGGAAGTTATACCTCGGGAGCTCTTATATCCCGCAGTCTTTGGCTCTGGCTTGGGGTCTTGGATGCATTACAA
GGCCTAGGATTTGGTATGATTCTGCTGCAAACACTGACACGTATGCACATCTGCTTCACCCTTCTGGTATCACAG
GTCCTGGGCTCTCTCGCAACTATTTGTGCAAGGGCCTTCGCACCAAACAACATTGGCCCAGGGCCTATCTCTCCA
GATATCACGGCTGGTGCGGGCGCTTTGGGTAACGCTTGGTTTTGGGTTGCTCTTTTATTGCAGCTCTCGATCTGT
GGTGGCTTTCTCCTTTTCTTCCGACGGGAGCAATTATCGAAGCCCTGA
Transcript >Pro_DTO377G3_2|g983.t1
ATGAATTGGAGATATAAAATCCCAGTCCTTGCTCTTCTCGCAGCTCCAGGAATCAGTTGGCCCTACGACGAGACT
CTCACTGATTATAACATCAACGAAAACCAAACAGCGACCAACCCCTTAGACTACTGGGGAGAATGGCCCGACCAC
ACCTACTTTCCTTCTCCAGAAAATTGGCGCTTTCCTGTATATACGCTTTTCCTTGACCGATTTGTGAACGGTGAT
CCAACAAACGACAATATAAATGGGACACTCTTTGAACATGATATCAATTCAAACCAAATGCGACACGGAGGTGAC
GTGGCTGGTTTGCTGGACACTTTGGACTATTTGCAAGGAATGGGCATCAAGGGACTTTATCTTGCAGGTTTGGTA
TTGATGAACCAGCCATGGGGGTCTGATGGTTACTCAGCGCTTGACACGACTCTACTCGACCAGCATTTTGGGACA
ATTAAAACATGGAGAACAGCTATAACGGAGATTCACAAGCGCGGCATGTACGTTATTTTTGACAATACGGTCTCA
ACCATGGGAGATCTCATTGGATTTGAAGGGTATATGAATACAACTACACCATTTTCGGTCAAAGAGCACAAGGCC
GCCTGGAAATCGGACCGTCAATATGTTGATTTTCGATATGGCAACACCTACAATGAGACATGTGAATATCCTCGC
TTCTGGAATGAGACCGGGTACCCCGTGGACGAGTACGTTAATTATGAGCTAGGCGGGTGCTACGACAGTGATTTT
GATCAATATGGCGATATCGAGGCCTTTGGTGTCTATCCCGACTGGAAACGAGAGCTCGCTAAATTTGCATCGGTG
CAAGACCGGCTGCGCGAATGGGTGTCTAGTGTCAAAAAGAGAATTATTCGTCATTCGTGTATGATCATCGCTTCT
TTCGACATCGACGGCTTTCGCTATGACAAAGCTACGCAAGCTACTGTCGATGCCCTTGGGGATATTTCTGAGGCG
TATCGAGGCTGTGCTCGCCGTGTGGGAAAAGACAATTTCTTCCTTCCGGGTGAGATTACAAGTGGAAATACTCTT
GGCTCTATCTTTCATGGGCGAGGACGTCAGCCTGATATGAAGTCCCAGACGCTTGATCAAGCCTTTATGATGACG
AATGCCTCTGATCCGGATTACTTTATCCGTGACCACAACAAGCAGGCGACTGATGCTGCCGCTTTTCATTACTCC
GTTTATCGCTCCCTCACCCGGTTCTTAGGTATGGATGGCAACTTGGCTGCTGGCTACGACGTTCCAGTTAATTGG
ACCGAGGCCTGGTATCAAATGGTCCTCACCAATGACATGATAAACGCGAACACTGGCAAATTTGATCCACGCCAT
ATGTATGGAGCTACAAACCAGGATGTGTTCCGATGGCCGACCGTTGAATATGGCGTTGAAAGGCAACTTCTTGCT
CTTTTCATCACGACATTGCACATGCCCGGCATTCCTATGCTCCTATGGGGCGAGGAACAAGCGTTTTATATTTTA
GATGCTTCAGCTGCTAACTATATATATGGCCGTCAAGCAATGTCTCCCGCGACAGCTTGGAAAATCCACGGATGT
TTCCAGTTGAATTCGACTCAATATTTCCAGTGGCCTATCAAGTCGGGACGTTTGGGATGCTACGATGAGACAGTC
ACGTATGACCACCGTGATCCAGCTCACCCCGTGCGGAACATTATCAAACACATGTACCAGATGCGACAGGACTTT
GGTGCTCTCAATGACGGGTGGTGGATTCAGCTACTCTCAAACCAAACACGTAACATATATCTCCCAGGTTCTGAC
GGAGTTGCAACAGAAACTGGCATGTGGTCTGTCCTTCGCAGTCCATATTACCAATTGCAGGATTTGGGAGAAATG
GGCAATCAAACGGTCTGGTTTGTATATCAAAATGACAACCGAACGGTGAACTATGAGTTCGACTGTTCTAACCAA
ACTGCCGCATTAATTGCTCCATTCGGTACCAATAGCACGGTGAAAAACCTGTTCTATCCCCACGATGAGTTGACA
CTGCAAGAGGGTCCAGTCAAACTTGGGTTGAACGGCTCTGACGATTACAACGGTTGCCTTGACAGTATGAGGCTT
CGACCATACGAATTTAGAGCCTACATCCGAAAAGAGAGATTTGTTTTCCCTCGTCCTATGATAACCAAGTTCATA
CCTGGACATGACACTCCATTGCTATCTGCTGTCGCGCCAGATGAAAGTGAGTCAGTGGATATCAGTTTGTTCTTC
TCCACAGAGATGAATTGCTCTATGGTGACCGAGTCAATATCGCTTGAATCGTCCACCGAGACTGGAGAACGGCCT
TCTTTGGACCTTGCCAGTGTTAATTGTGGGAGTGTTGAACCGGAGATTACTTCTTGGACAGGACAAATTCCATCT
ACTTGGTCTTGGACAGGTACCCTGACTGGTGTCTACAATGGCGTGCATAAATTGACAGTGAACAACGCGACAACT
CCCGATGGGAGGGCAACTAACGCCGTCGACCATTTCTTGTTCCGAGTCGGGCAGTCTGATAACCCCATGATCTTT
ACCACGGCAAATTACTCCAGCAGCTTGCTTCACAGCCGCGATGATGGTACTCTTTTCATTGCACAACATGCAGCA
GGGGCAGATAAATATCGGTACTCTACAAATTGGGGTAGTACTTTCACTGAATGGCTACCATACGTGGGAGGAAAC
CATACCATTGAAGAACTGCCTTGGTCTGGAACAAAGAAGCAGGGATGGGATGGGAAACACGTTCGGGTTGAGTAC
TGGAGTCGCCTTACAGGTAGCAGCGACTACATCCAAGAGGGCGACGGACCGGGCTGGAGTCCTGCTATCCGACGT
CGGTTCCCTCATCTCTTTTTTAATGGACCTTTCAACAGGTACGGATATGATGCCGGCTTGGATAACGTCGTGAGG
CAAGATACCGATGGCCTATGGAAATTCCGCTTTATGACTGAATGGCCTGCCCAGGGTCAGCTGAACGTCTGGGGT
ATAAACCCCGATAATCAACCGGACCAAAGTTACATCTACGGAGATTCCGATGGAGACTCAATCCTCGACCGTCTA
CCGCCCTCTTCGCTAAGTGTGACAAGCATAAACATCACTCGGCATCCACCGAGCCCGCACCTCGCTTGGAGGATT
CAACTCGATGACTCAAATTTGCAGTTCAAGCTTGTTCCTACAGGCTCCAAATACGTTCAAATGGCTCTTTTTATC
CTTCTTTGCATTGTTCCTGTCATTACAGCGTCAACCTGCGCTTATGTGTTCATGAAAACATTCTATCGGATCAAG
TTCAACCAAGTTGGCGTGAGTGAAAAAAAGACGCTCATTTCAATGGATTTCATCAATAAATTCGAGGTAGGCCAC
GTGGAAGATGGACAGTCTAGAAACCCATTCAGACGACTTACAAGCAGGTCAAACTTCCTTCAAAGTACTTCTGCT
TTTGGTAATCGCACTGCCCACCGACGAAAAGTTCTGATTGCAACCATGGAATATGAGATCGACGACTGGGCTATC
AAGATAAAAATTGGTGGCTTGGGTGTTATGGCACAGTTAATGGGCAAACAACTCGGACATCAGGATCTTATCTGG
GTTATTCCCTGCGTGGGTGGAGTAAAGTATCCTGTCGATAAACAGGCAGATTCGATGTTTGTCATGATCTTGGGG
AATTCGTATGAAATCAAGATTCAGTACCACCAACTGAGGAACATCACATATGTTTTGCTGGATGCGCCTGTTTTT
CGCCAGCAATCCGTTATAGAGCCTTATCCAGCCCGAATGGACGACCTCGACAGCGCTATTTACTATTCTGCGTGG
AACCAATGCATTGCCCAGGCGATGAAGCGGTTTCCAGTTGATCTGTATCACATCAATGACTATCACGGCTCGGTG
GCACCGTTATATCTTTTGCCCGAGACTATTCCTATTTGCTTATCGCTCCACAACGCCGAATTTCAAGGTTTATGG
CCTATGCGAACACAGAAAGAGAGAACCGAAGTCTGTTCTGTTTTCAACCTTGATTTGGATATTGTCACACGCTAT
GTTCAGTTCGGCGAGATCTTCAATCTTCTTCATGCCGGGGCAAGCTATCTGCGCCTTCATCAACAAGGCTTTGGT
GCCGTTGGTGTGTCGAAGAAGTATGGAAAGCGGTCATATGCTCGATACCCGATCTTTTGGGGCTTGAGAAAAGTT
GGAAACCTACCGAATCCCGACCCCTCTGATACAGGCGAGTGGGATAGATCCTTACCTAAGGAGAGAGATATTGGC
ATCGACAATGACTTCGAGATCCGCAGAGCCGAGCTAAAGCGCCAAGCTCAAGAATGGGCTGGTCTTAAGCAAAGA
CCTGACGCGGATCTGTTAGTCTTCGTTGGAAGATGGTCGATGCAAAAAGGTATCGACCTGATAGCTGATGTCTTG
CCTGGTGTATTGGAGAATCGAGAAAACGTTCAGCTGATCTGCATCGGTCCCCTTATTGATTTATATGGCAAATTT
GCCGCGTTGAAACTGGATCGAATGACGAAGCTTTACCCTGGTCGAGTATGCTCTAAACCCCAGTTCACGGTATTA
CCACACTTCATCTTCTCTGGTGCAGATTTTGCACTAATTCCGTCACGCGATGAACCCTTCGGTCTTGTCGCTGTC
GAATTCGGTCGGAAGGGTGCCCTTGGGATTGGCGCCAGAGTAGGGGGACTTGGGCAGATGCCTGGCTGGTGGTAT
ACGGTTGAGTCCACGACTACCTCCCACCTATTGAAACAGTTCAAATTGGCCATCGACAGTGCATTAAACTCCAAG
CCCGAGGTGAGGGCGATGATGCGCGCAAGGTCTGCCAAGCAACGATTCCCAGTTGTCCAATGGGTCGATGATCTT
GAGATCTTACAGTCCACATCGATTCGAGTCCATCAAAAGGAACGAACCAAATCCCACAGCCAGTCCGCTGCTGCT
GGTGCATACAATGCCATCTACGGGATTATGACGCCACAAACTGCGTCAACAAGATCGGGCGCATCAACACCTCCA
TTACAACCCTCAAGTCGCCCGGGTATTGTAGGGTCACTACAGCGAAGCTCTATAATCTACAGTCGTGATGCAAGC
CCTGGATTCAATGGGAGACCTAAATCGGGACTAAGTCGCCAGATATCTCATGGTGTTCAGCCGGTATCCGGCACC
ATTGAGCCTCGTGGTCGGCCCGACGTCGGGAAAGTCGGTGTTATCGAGGGTGACGACAGCGCTAGTGGAGCCTCT
CCAGAGGCCGAAGAAAATAGCGACGATGAAATGATGGATACCTGCTATGGTGATGATGATTATTCCATGCCACCT
GAAGGAGTAGGCCTAGGTCGTGCACAAACTCCTCAACCCAGTTTGGCGCTCACCAAAGAGGCTCTCTCGGCCCAA
CGCACGAGTCAAAGCTCCTTGTTGGCTCGGTGCAGCAACACGCCCTCTAGTTCAACGGCACCGAGTACTGTCGGG
ACAGATGATACCCTTATCCCCCCTTCTCGTCCATGGGCAGAGCCAGGAAACCGTCTCAGTAATGCCTCAGTCTTG
TCTGTCAATTCGGTTGTTGGAGAGAAGAAAGACTTCAAACTTCAAAAGGTTGACCCGTACTTTACCGACAGCAAT
GGCGAGTACTACAGAGTGTTTGAAAAAAGACTCGAGGAACTGAATGGGGCGAACTCAGACACCCAACTCTGCATT
GAGCAATACCTTGAGAAAAGCGAAAAGAAATGGTTCAACAAATTCCGTGATGCACGCCTTGGCCTCCATCAAGGA
TCGCCAGCTGTCTCAATGCATCGTGGCAAAGCAGAGACATCCCCGACGGGGTCAGTTGCCAACGACGATGCGACA
TCCCATGAAAGTGGTGAGCGCGAAAGAAAAGGTGCTCCGCCTGATGAATTCCTTCTTGGTGATGACTACGTGCCA
CCAACAGGGCTGAAAAAATGGATGCAAATGCGCATCGGAGAATGGCCGGTATATTCTCTCTTCCTCGGGCTAGGT
CAGATCATTGCTGCCAATTCCTACCAGATTACCCTTCTCACTGGTGAGGTCGGTCAGACTGCTACAAAGTTGTAC
GGAATTGCGACGGTTTACCTGATTACTTCTATTCTATGGTGGTTTTTCTTCCGATACTACAAATCCGTGCTCGTT
TTGAGTGTGCCGTGGATCTTATACGGAACAGCCTTTTTGATCATCGGAATGGCACACTTTGAGCCTAACTCACAC
AATCGCGGATGGATTCAAAACGTTGGAAGTAGTGTCTATGCGGCTGCATCATCGAGCGGTTCCATCTTCTTCGCC
CTCAATTTCGGCGATGAGAGCGGTGCACCGGTCAACCAGTGGGTATTCCGTGCTTGTCTTATCCAGGGCACGCAG
CAAGCCTATGTCATTGCTCTTTGGTACTGGGGTTCAACTTTGACTAAAGCAACGAACGCGGGAATTACGGATGTG
CAGGTTAGCGTCACCAATACCTGGAGGATGACAGCAATATGTACACCAGTCGCTCTCATTTTATGGGCGATTGGC
CTTATCGTATATTTTGGCTTGCCAAACTACTATCGCCAAATTCCCGGCAAAGTGCCATCATTCTACAAATCTGTC
TTCCGGCGCAAGATTGTACTTTGGAACTGGGTGGTCGTTATTCTCCAGAACTTCTTTTTGAGTGCTCCATATGGC
CGAAACTGGAATTTCCTGTGGATTACCCAGCACGCCAGCTCGTGGCAAATCCTACTTCTCTGTGTTGCATTCTTC
GGCTTTGTCTGGATAGCAGTTCTCTTCCTGCTGGCTAGGCTATCTAAGTCCCATAGTTGGATCCTCCCGGTTCTC
GCATGTGGTCTGGGTGCACCTCGTTGGGCCCAGATCTGGTGGGGCACATCTGGGTCTGGGCTGTTCCTCCCCTGG
GCTGGAAGTTATACCTCGGGAGCTCTTATATCCCGCAGTCTTTGGCTCTGGCTTGGGGTCTTGGATGCATTACAA
GGCCTAGGATTTGGTATGATTCTGCTGCAAACACTGACACGTATGCACATCTGCTTCACCCTTCTGGTATCACAG
GTCCTGGGCTCTCTCGCAACTATTTGTGCAAGGGCCTTCGCACCAAACAACATTGGCCCAGGGCCTATCTCTCCA
GATATCACGGCTGGTGCGGGCGCTTTGGGTAACGCTTGGTTTTGGGTTGCTCTTTTATTGCAGCTCTCGATCTGT
GGTGGCTTTCTCCTTTTCTTCCGACGGGAGCAATTATCGAAGCCCTGA
Gene >Pro_DTO377G3_2|g983.t1
ATGAATTGGAGATATAAAATCCCAGTCCTTGCTCTTCTCGCAGCTCCAGGAATCAGTTGGCCCTACGACGAGACT
CTCACTGATTATAACATCAACGAAAACCAAACAGCGACCAACCCCTTAGACTACTGGGGAGAATGGCCCGACCAC
ACCTACTTTCCTTCTCCAGAAAATTGGCGCTTTCCTGTATATACGCTTTTCCTTGACCGATTTGTGAACGGTGAT
CCAACAAACGACAATATAAATGGGACACTCTTTGAACATGATATCAATTCAAACCAAATGCGACACGGAGGTGAC
GTGGCTGGTTTGCTGGACACTTTGGACTATTTGCAAGGAATGGGCATCAAGGTTAGCTTCATGAATGGAACCTTG
GTGCATATCTAATATCAACTGACAGTTGAACTTCTAGGGACTTTATCTTGCAGGTTTGGTATTGATGAACCAGCC
ATGGGGGTCTGATGGTTACTCAGCGCTTGACACGACTCTACTCGACCAGCATTTTGGGACAATTAAAACATGGAG
AACAGCTATAACGGAGATTCACAAGCGCGGCATGTACGTTATTTTTGACAATACGGTCTCAACGTAAGTCTTCCG
TCTAACCATCTTCTCTTATTGTGTGACAAGAATCTAACAGCACTAGCATGGGAGATCTCATTGGATTTGAAGGGT
ATATGAATACAACTACACCATTTTCGGTCAAAGAGCACAAGGCCGCCTGGAAATCGGACCGTCAATATGTTGATT
TTCGATATGGCAACACCTACAATGAGACATGTGAATATCCTCGCTTCTGGAATGAGACCGGGTACCCCGTGGACG
AGTACGTTAATTATGAGCTAGGCGGGTGCTACGACAGTGATTTTGATCAATATGGCGATATCGAGGCCTTTGGTG
TCTATCCCGACTGGAAACGAGAGCTCGCTAAATTTGCATCGGTGCAAGACCGGCTGCGCGAATGGGTGTCTAGTG
TCAAAAAGAGAATTATTCGTCATTCGTGTATGATCATCGCTTCTTTCGACATCGACGGCTTTCGCTATGACAAAG
CTACGCAAGCTACTGTCGATGCCCTTGGGGATATTTCTGAGGCGTATCGAGGCTGTGCTCGCCGTGTGGGAAAAG
ACAATTTCTTCCTTCCGGGTGAGATTACAAGTGGAAATACTCTTGGCTCTATCTTTCATGGGCGAGGACGTCAGC
CTGATATGAAGTCCCAGACGCTTGATCAAGCCTTTATGATGACGAATGCCTCTGATCCGGATTACTTTATCCGTG
ACCACAACAAGCAGGCGACTGATGCTGCCGCTTTTCATTACTCCGTTTATCGCTCCCTCACCCGGTTCTTAGGTA
TGGATGGCAACTTGGCTGCTGGCTACGACGTTCCAGTTAATTGGACCGAGGCCTGGTATCAAATGGTCCTCACCA
ATGACATGATAAACGCGAACACTGGCAAATTTGATCCACGCCATATGTATGGAGCTACAAACCAGGATGTGTTCC
GATGGCCGACCGTTGAATATGGCGTTGAAAGGCAACTTCTTGCTCTTTTCATCACGACATTGCACATGCCCGGCA
TTCCTATGCTCCTATGGGGCGAGGAACAAGCGTTTTATATTTTAGATGCTTCAGCTGCTAACTATATATATGGCC
GTCAAGCAATGTCTCCCGCGACAGCTTGGAAAATCCACGGATGTTTCCAGTTGAATTCGACTCAATATTTCCAGT
GGCCTATCAAGTCGGGACGTTTGGGATGCTACGATGAGACAGTCACGTATGACCACCGTGATCCAGCTCACCCCG
TGCGGAACATTATCAAACACATGTACCAGATGCGACAGGACTTTGGTGCTCTCAATGACGGGTGGTGGATTCAGC
TACTCTCAAACCAAACACGTAACATATATCTCCCAGGTTCTGACGGAGTTGCAACAGAAACTGGCATGTGGTCTG
TCCTTCGCAGTCCATATTACCAATTGCAGGATTTGGGAGAAATGGGCAATCAAACGGTCTGGTTTGTATATCAAA
ATGACAACCGAACGGTGAACTATGAGTTCGACTGTTCTAACCAAACTGCCGCATTAATTGCTCCATTCGGTACCA
ATAGCACGGTGAAAAACCTGTTCTATCCCCACGATGAGTTGACACTGCAAGAGGGTCCAGTCAAACTTGGGTTGA
ACGGCTCTGACGATTACAACGGTTGCCTTGACAGTATGAGGCTTCGACCATACGAATTTAGAGCCTACATCCGAA
AAGAGAGATTTGTTTTCCCTCGTCCTATGATAACCAAGTTCATACCTGGACATGACACTCCATTGCTATCTGCTG
TCGCGCCAGATGAAAGTGAGTCAGTGGATATCAGTTTGTTCTTCTCCACAGAGATGAATTGCTCTATGGTGACCG
AGTCAATATCGCTTGAATCGTCCACCGAGACTGGAGAACGGCCTTCTTTGGACCTTGCCAGTGTTAATTGTGGGA
GTGTTGAACCGGAGATTACTTCTTGGACAGGACAAATTCCATCTACTTGGTCTTGGACAGGTACCCTGACTGGTG
TCTACAATGGCGTGCATAAATTGACAGTGAACAACGCGACAACTCCCGATGGGAGGGCAACTAACGCCGTCGACC
ATTTCTTGTTCCGAGTCGGGCAGTCTGATAACCCCATGATCTTTACCACGGCAAATTACTCCAGCAGCTTGCTTC
ACAGCCGCGATGATGGTACTCTTTTCATTGCACAACATGCAGCAGGGGCAGATAAATATCGGTACTCTACAAATT
GGGGTAGTACTTTCACTGAATGGCTACCATACGTGGGAGGAAACCATACCATTGAAGAACTGCCTTGGTCTGGAA
CAAAGAAGCAGGGATGGGATGGGAAACACGTTCGGGTTGAGTACTGGAGTCGCCTTACAGGTAGCAGCGACTACA
TCCAAGAGGGCGACGGACCGGGCTGGAGTCCTGCTATCCGACGTCGGTTCCCTCATCTCTTTTTTAATGGACCTT
TCAACAGGTACGGATATGATGCCGGCTTGGATAACGTCGTGAGGCAAGATACCGATGGCCTATGGAAATTCCGCT
TTATGACTGAATGGCCTGCCCAGGGTCAGCTGAACGTCTGGGGTATAAACCCCGATAATCAACCGGACCAAAGTT
ACATCTACGGAGATTCCGATGGAGACTCAATCCTCGACCGTCTACCGCCCTCTTCGCTAAGTGTGACAAGCATAA
ACATCACTCGGCATCCACCGAGCCCGCACCTCGCTTGGAGGATTCAACTCGATGACTCAAATTTGCAGTTCAAGC
TTGTTCCTACAGGCTCCAAATACGTTCAAATGGCTCTTTTTATCCTTCTTTGCATTGTTCCTGTCATTACAGCGT
CAACCTGCGCTTATGTGTTCATGAAAACATTCTATCGGATCAAGTTCAACCAAGTTGGCGTGAGTGAAAAAAAGA
CGCTCATTTCAATGGATTTCATCAATAAATTCGAGGTAGGCCACGTGGAAGATGGACAGTCTAGAAACCCATTCA
GACGACTTACAAGCAGGTCAAACTTCCTTCAAAGTACTTCTGCTTTTGGTAATCGCACTGCCCACCGACGAAAAG
TTCTGATTGCAACCATGGAATATGAGATCGACGACTGGGCTATCAAGATAAAAATTGGTGGCTTGGGTGTTATGG
CACAGTTAATGGGCAAACAACTCGGACATCAGGATCTTATCTGGGTTATTCCCTGCGTGGGTGGAGTAAAGTATC
CTGTCGATAAACAGGCAGATTCGATGTTTGTCATGATCTTGGGGAATTCGTATGAAATCAAGATTCAGTACCACC
AACTGAGGAACATCACATATGTTTTGCTGGATGCGCCTGTTTTTCGCCAGCAATCCGTTATAGAGCCTTATCCAG
CCCGAATGGACGACCTCGACAGCGCTATTTACTATTCTGCGTGGAACCAATGCATTGCCCAGGCGATGAAGCGGT
TTCCAGTTGATCTGTATCACATCAATGACTATCACGGCTCGGTGGCACCGTTATATCTTTTGCCCGAGACTATTC
CTATTTGCTTATCGCTCCACAACGCCGAATTTCAAGGTTTATGGCCTATGCGAACACAGAAAGAGAGAACCGAAG
TCTGTTCTGTTTTCAACCTTGATTTGGATATTGTCACACGCTATGTTCAGTTCGGCGAGATCTTCAATCTTCTTC
ATGCCGGGGCAAGCTATCTGCGCCTTCATCAACAAGGCTTTGGTGCCGTTGGTGTGTCGAAGAAGTATGGAAAGC
GGTCATATGCTCGATACCCGATCTTTTGGGGCTTGAGAAAAGTTGGAAACCTACCGAATCCCGACCCCTCTGATA
CAGGCGAGTGGGATAGATCCTTACCTAAGGAGAGAGATATTGGCATCGACAATGACTTCGAGATCCGCAGAGCCG
AGCTAAAGCGCCAAGCTCAAGAATGGGCTGGTCTTAAGCAAAGACCTGACGCGGATCTGTTAGTCTTCGTTGGAA
GATGGTCGATGCAAAAAGGTATCGACCTGATAGCTGATGTCTTGCCTGGTGTATTGGAGAATCGAGAAAACGTTC
AGCTGATCTGCATCGGTCCCCTTATTGATTTATATGGCAAATTTGCCGCGTTGAAACTGGATCGAATGACGAAGC
TTTACCCTGGTCGAGTATGCTCTAAACCCCAGTTCACGGTATTACCACACTTCATCTTCTCTGGTGCAGATTTTG
CACTAATTCCGTCACGCGATGAACCCTTCGGTCTTGTCGCTGTCGAATTCGGTCGGAAGGGTGCCCTTGGGATTG
GCGCCAGAGTAGGGGGACTTGGGCAGATGCCTGGCTGGTGGTATACGGTTGAGTCCACGACTACCTCCCACCTAT
TGAAACAGTTCAAATTGGCCATCGACAGTGCATTAAACTCCAAGCCCGAGGTGAGGGCGATGATGCGCGCAAGGT
CTGCCAAGCAACGATTCCCAGTTGTCCAATGGGTCGATGATCTTGAGATCTTACAGTCCACATCGATTCGAGTCC
ATCAAAAGGAACGAACCAAATCCCACAGCCAGTCCGCTGCTGCTGGTGCATACAATGCCATCTACGGGATTATGA
CGCCACAAACTGCGTCAACAAGATCGGGCGCATCAACACCTCCATTACAACCCTCAAGTCGCCCGGGTATTGTAG
GGTCACTACAGCGAAGCTCTATAATCTACAGTCGTGATGCAAGCCCTGGATTCAATGGGAGACCTAAATCGGGAC
TAAGTCGCCAGATATCTCATGGTGTTCAGCCGGTATCCGGCACCATTGAGCCTCGTGGTCGGCCCGACGTCGGGA
AAGTCGGTGTTATCGAGGGTGACGACAGCGCTAGTGGAGCCTCTCCAGAGGCCGAAGAAAATAGCGACGATGAAA
TGATGGATACCTGCTATGGTGATGATGATTATTCCATGCCACCTGAAGGAGTAGGCCTAGGTCGTGCACAAACTC
CTCAACCCAGTTTGGCGCTCACCAAAGAGGCTCTCTCGGCCCAACGCACGAGTCAAAGCTCCTTGTTGGCTCGGT
GCAGCAACACGCCCTCTAGTTCAACGGCACCGAGTACTGTCGGGACAGATGATACCCTTATCCCCCCTTCTCGTC
CATGGGCAGAGCCAGGAAACCGTCTCAGTAATGCCTCAGTCTTGTCTGTCAATTCGGTTGTTGGAGAGAAGAAAG
ACTTCAAACTTCAAAAGGTTGACCCGTACTTTACCGACAGCAATGGCGAGTACTACAGAGTGTTTGAAAAAAGAC
TCGAGGAACTGAATGGGGCGAACTCAGACACCCAACTCTGCATTGAGCAATACCTTGAGAAAAGCGAAAAGAAAT
GGTTCAACAAATTCCGTGATGCACGCCTTGGCCTCCATCAAGGATCGCCAGCTGTCTCAATGCATCGTGGCAAAG
CAGAGACATCCCCGACGGGGTCAGTTGCCAACGACGATGCGACATCCCATGAAAGTGGTGAGCGCGAAAGAAAAG
GTGCTCCGCCTGATGAATTCCTTCTTGGTGATGACTACGTGCCACCAACAGGGCTGAAAAAATGGATGCAAATGC
GCATCGGAGAATGGCCGGTATATTCTCTCTTCCTCGGGCTAGGTCAGATCATTGCTGCCAATTCCTACCAGATTA
CCCTTCTCACTGGTGAGGTCGGTCAGACTGCTACAAAGTTGTACGGAATTGCGACGGTTTACCTGATTACTTCTA
TTCTATGGTGGTTTTTCTTCCGATACTACAAATCCGTGCTCGTTTTGAGTGTGCCGTGGATCTTATACGGAACAG
CCTTTTTGATCATCGGAATGGCACACTTTGAGCCTAACTCACACAATCGCGGATGGATTCAAAACGTTGGAAGTA
GTGTCTATGCGGCTGCATCATCGAGCGGTTCCATCTTCTTCGCCCTCAATTTCGGCGATGAGAGCGGTGCACCGG
TCAACCAGTGGGTATTCCGTGCTTGTCTTATCCAGGGCACGCAGCAAGCCTATGTCATTGCTCTTTGGTACTGGG
GTTCAACTTTGACTAAAGCAACGAACGCGGGAATTACGGATGTGCAGGTTAGCGTCACCAATACCTGGAGGATGA
CGTGCGTATAACATTGAAATCTTCATCTCAAGGATCGGAGAGTTGCTAACCATTTTTCATAGAGCAATATGTACA
CCAGTCGCTCTCATTTTATGGGCGATTGGCCTTATCGTATATTTTGGCTTGCCAAACTACTATCGCCAAATTCCC
GGCAAAGTGCCATCATTCTACAAATCTGTCTTCCGGCGCAAGATTGTACTTTGGAACTGGGTGGTCGTTATTCTC
CAGAACTTCTTTTTGAGTGCTCCATATGGCCGAAACTGGAATTGTGAGTATCCATTGGGCAGACAGTTTATACGG
GTCTTCTTCCTTCCTATTCCTCGAATTACGCTAATGATTATCACAGTCCTGTGGATTACCCAGCACGCCAGCTCG
TGGCAAATCCTACTTCTCTGTGTTGCATTCTTCGGCTTTGTCTGGATAGCAGTTCTCTTCCTGCTGGCTAGGCTA
TCTAAGTCCCATAGTTGGATCCTCCCGGTTCTCGCATGTGGTCTGGGTGCACCTCGTTGGGCCCAGATCTGGTGG
GGCACATCTGGGTCTGGGCTGTTCCTCCCCTGGGCTGGAAGTTATACCTCGGGAGCTCTTATATCCCGCAGTCTT
TGGCTCTGGCTTGGGGTCTTGGATGCATTACAAGGCCTAGGATTTGGTATGATTCTGCTGCAAACACTGACACGT
ATGCACATCTGCTTCACCCTTCTGGTATCACAGGTCCTGGGCTCTCTCGCAACTATTTGTGCAAGGGCCTTCGCA
CCAAACAACATTGGCCCAGGGCCTATCTCTCCAGATATCACGGCTGGTGCGGGCGCTTTGGGTAACGCTTGGTTT
TGGGTTGCTCTTTTATTGCAGCTCTCGATCTGGTATGTGCGCCCTTGTAAGGATATGAGAACCCCGTCTAACGTC
TAGATTGAAGTGGTGGCTTTCTCCTTTTCTTCCGACGGGAGCAATTATCGAAGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail