Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g975.t1
Gene name
Locationscaffold_01:2584233..2585767
Strand-
Gene length (bp)1534
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 3.3E-63 33 288
PF02803 Thiolase_C Thiolase, C-terminal domain 1.2E-42 297 415

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 12.61 5.32 19.91
5d_25C Five days - 25 degrees Celsius 7.52 2.65 12.39
7d_25C Seven days - 25 degrees Celsius 6.88 2.18 11.59
10d_25C Ten days - 25 degrees Celsius 4.97 1.36 8.58
7d_15C Seven days - 15 degrees Celsius 9.05 3.22 14.87
7d_30C Seven days - 30 degrees Celsius 11.87 4.84 18.91

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.142038 no
3d_25C 7d_25C 0.077844 no
3d_25C 7d_15C 0.391695 no
3d_25C 7d_30C 0.904079 no
3d_25C 10d_25C 0.009770 yes
5d_25C 7d_25C 0.872254 no
5d_25C 7d_15C 0.691597 no
5d_25C 7d_30C 0.199428 no
5d_25C 10d_25C 0.321934 no
7d_25C 7d_15C 0.531421 no
7d_25C 7d_30C 0.115777 no
7d_25C 10d_25C 0.472425 no
7d_15C 7d_30C 0.500239 no
7d_15C 10d_25C 0.125400 no
7d_30C 10d_25C 0.015558 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g975.t1
MSSPQQRLSSVANQLAAPGSARQKLLAKNPDDVVITYLARTPLTKARKGGLKDTSVDDLLISLLTTVREKSNLDP
NLVEDVCVGNVLCPGSAYVARSAVLAAGYPVTAAASIANRFCSSGLLAVQNIANQITAGSIDVGVAVGAESMSKN
ADGGAPEMSERIAKHPIASQNSLPMGQTSENVANQFNITREQHDRFAANSFQKAERAQKAGWLDDEIVPVKTQIK
DPKTGEVKDIVVDRDDGIRYGTTPESLGKVRAAFPQWAPSATTGGNASQITDGAAALVLMKRSRAQELGQPIVAK
FCGATVSGLEPRIMGIGPSLAIPKILNKFNLSKDDIDIFEINEAFASMGVYCVNKLGLDESKVNPRGGAIAFGHP
LGATGARQVVTALSELRRQDKRIAVTSMCVGTGMGMAGIFVSEH*
Coding >Pro_DTO377G3_2|g975.t1
ATGTCTTCACCGCAACAACGTTTAAGCTCCGTCGCCAACCAGCTGGCAGCTCCTGGCTCAGCCCGCCAGAAGCTT
CTGGCAAAGAACCCAGATGATGTGGTTATCACTTACCTAGCCAGGACGCCGCTCACCAAGGCCCGCAAAGGTGGA
TTGAAAGATACCTCCGTAGATGACCTCCTCATTTCACTCCTCACGACCGTCCGCGAGAAATCCAATCTGGACCCC
AACCTCGTTGAAGATGTCTGCGTTGGCAACGTCCTCTGCCCCGGTTCGGCATATGTCGCCCGCTCCGCGGTGCTG
GCAGCAGGCTATCCCGTAACAGCAGCGGCCTCCATCGCCAACCGATTTTGCTCCTCGGGTCTTCTAGCCGTGCAA
AACATCGCCAACCAAATCACCGCCGGATCCATCGATGTCGGAGTGGCCGTTGGAGCCGAGAGCATGAGCAAGAAC
GCCGACGGCGGCGCCCCTGAAATGTCCGAGCGCATCGCCAAGCACCCGATCGCATCCCAGAACTCCCTACCCATG
GGCCAGACCTCGGAGAATGTAGCTAACCAGTTCAATATCACGCGCGAGCAGCACGACAGGTTCGCTGCCAACAGT
TTTCAGAAGGCTGAGCGCGCCCAGAAGGCCGGATGGCTTGATGACGAGATTGTACCCGTCAAGACTCAAATTAAG
GATCCCAAGACCGGCGAGGTGAAGGATATCGTCGTTGATCGCGACGACGGCATCCGCTATGGCACGACCCCTGAG
TCCCTCGGCAAGGTCCGCGCTGCCTTCCCGCAGTGGGCCCCTAGTGCCACCACCGGTGGTAACGCCAGTCAGATT
ACCGACGGTGCTGCTGCGCTGGTTCTCATGAAACGCTCGCGCGCCCAGGAGCTCGGTCAGCCGATTGTTGCCAAG
TTCTGTGGTGCTACTGTTTCTGGTCTGGAGCCTAGAATTATGGGGATTGGCCCATCCCTTGCCATCCCTAAGATT
CTGAATAAGTTCAACCTGAGCAAGGATGACATTGATATTTTTGAGATTAACGAGGCCTTTGCCTCAATGGGTGTT
TACTGTGTTAACAAGCTAGGCTTGGATGAATCCAAGGTGAACCCGCGTGGTGGTGCTATTGCTTTTGGTCACCCT
CTGGGCGCCACTGGTGCACGTCAGGTCGTCACTGCTCTGTCTGAGCTGCGTCGACAGGATAAGCGGATTGCTGTG
ACTTCGATGTGTGTGGGCACTGGCATGGGGATGGCAGGTATCTTTGTTTCTGAGCATTAA
Transcript >Pro_DTO377G3_2|g975.t1
ATGTCTTCACCGCAACAACGTTTAAGCTCCGTCGCCAACCAGCTGGCAGCTCCTGGCTCAGCCCGCCAGAAGCTT
CTGGCAAAGAACCCAGATGATGTGGTTATCACTTACCTAGCCAGGACGCCGCTCACCAAGGCCCGCAAAGGTGGA
TTGAAAGATACCTCCGTAGATGACCTCCTCATTTCACTCCTCACGACCGTCCGCGAGAAATCCAATCTGGACCCC
AACCTCGTTGAAGATGTCTGCGTTGGCAACGTCCTCTGCCCCGGTTCGGCATATGTCGCCCGCTCCGCGGTGCTG
GCAGCAGGCTATCCCGTAACAGCAGCGGCCTCCATCGCCAACCGATTTTGCTCCTCGGGTCTTCTAGCCGTGCAA
AACATCGCCAACCAAATCACCGCCGGATCCATCGATGTCGGAGTGGCCGTTGGAGCCGAGAGCATGAGCAAGAAC
GCCGACGGCGGCGCCCCTGAAATGTCCGAGCGCATCGCCAAGCACCCGATCGCATCCCAGAACTCCCTACCCATG
GGCCAGACCTCGGAGAATGTAGCTAACCAGTTCAATATCACGCGCGAGCAGCACGACAGGTTCGCTGCCAACAGT
TTTCAGAAGGCTGAGCGCGCCCAGAAGGCCGGATGGCTTGATGACGAGATTGTACCCGTCAAGACTCAAATTAAG
GATCCCAAGACCGGCGAGGTGAAGGATATCGTCGTTGATCGCGACGACGGCATCCGCTATGGCACGACCCCTGAG
TCCCTCGGCAAGGTCCGCGCTGCCTTCCCGCAGTGGGCCCCTAGTGCCACCACCGGTGGTAACGCCAGTCAGATT
ACCGACGGTGCTGCTGCGCTGGTTCTCATGAAACGCTCGCGCGCCCAGGAGCTCGGTCAGCCGATTGTTGCCAAG
TTCTGTGGTGCTACTGTTTCTGGTCTGGAGCCTAGAATTATGGGGATTGGCCCATCCCTTGCCATCCCTAAGATT
CTGAATAAGTTCAACCTGAGCAAGGATGACATTGATATTTTTGAGATTAACGAGGCCTTTGCCTCAATGGGTGTT
TACTGTGTTAACAAGCTAGGCTTGGATGAATCCAAGGTGAACCCGCGTGGTGGTGCTATTGCTTTTGGTCACCCT
CTGGGCGCCACTGGTGCACGTCAGGTCGTCACTGCTCTGTCTGAGCTGCGTCGACAGGATAAGCGGATTGCTGTG
ACTTCGATGTGTGTGGGCACTGGCATGGGGATGGCAGGTATCTTTGTTTCTGAGCATTAA
Gene >Pro_DTO377G3_2|g975.t1
ATGTCTTCACCGCAACAACGTTTAAGCTCCGTCGCCAACCAGCTGGCAGCTCCTGGCTCAGCCCGCCAGAAGCTT
CTGGCAAAGAACCCAGATGATGTGGTATGTCACTGATTGCAGCTGCAACTTCATTGCCATAATTAATCAATAATC
GGCAGGTTATCACTTACCTAGCCAGGACGCCGCTCACCAAGGCCCGCAAAGGTGGATTGAAAGATACCTCCGTAG
ATGACCTCCTCATTTCACTCCTCACGGTACTTCTTCCTCCGTGATTAGAGGCGAAAATTGCAGTAATTAATACAT
CAAGAAGACCGTCCGCGAGAAATCCAATCTGGACCCCAACCTCGTTGAAGATGTCTGCGTTGGCAACGTCCTCTG
CCCCGGTTCGGCATATGTCGCCCGCTCCGCGGTGCTGGCAGCAGGCTATCCCGTAACAGCAGCGGCCTCCATCGC
CAACCGATTTTGCTCCTCGGGTCTTCTAGCCGTGCAAAACATCGCCAACCAAATCACCGCCGGATCCATCGATGT
CGGAGTGGCCGTTGGAGCCGAGAGCATGAGCAAGAACGCCGACGGCGGCGCCCCTGAAATGTCCGAGCGCATCGC
CAAGCACCCGATCGCATCCCAGAACTCCCTACCCATGGGCCAGACCTCGGAGAATGTAGCTAACCAGTTCAATAT
CACGCGCGAGCAGCACGACAGGTTCGCTGCCAACAGTTTTCAGAAGGCTGAGCGCGCCCAGAAGGCCGGATGGCT
TGATGACGAGATTGTACCCGTCAAGACTCAAATTAAGGATCCCAAGACCGGCGAGGTGAAGGATATCGTCGTTGA
TCGCGACGACGGCATCCGCTATGGCACGACCCCTGAGTCCCTCGGCAAGGTCCGCGCTGCCTTCCCGCAGTGGGC
CCCTAGTGCCACCACCGGTGGTAACGCCAGTCAGATTACCGACGGTGCTGCTGCGCTGGTTCTCATGAAACGCTC
GCGCGCCCAGGAGCTCGGTCAGCCGATTGTTGCCAAGTTCTGTGGTGCTACTGTTTCTGGTCTGGAGCCTAGAAT
TATGGGGATTGGCCCATCCCTTGCCATCCCTAAGATTCTGAATAAGTTCAACCTGAGCAAGGATGACATTGATAT
TTTTGAGATTAACGAGGCCTTTGCCTCAATGGTAAGTTTATCATGTGACTATACATTAAGCAAGACTAACACTCG
TTATTACAGGGTGTTTACTGTGTTAACAAGCTAGGCTTGGATGAATCCAAGGTGAACCCGCGTGGTGGTGCTATG
TAAGTGAGCTCCGACCAGATTTGATGGACGCCGTGCTGATGTCTCAAAGTGCTTTTGGTCACCCTCTGGGCGCCA
CTGGTGCACGTCAGGTCGTCACTGCTCTGTCTGAGCTGCGTCGACAGGATAAGCGGATTGCTGTGACTTCGATGT
GTGTGGGCACTGTAAGTTACCTTCGATTATCACGACCTCGAGTATTGAAATAACTAATTGTTTTGAATAGGGCAT
GGGGATGGCAGGTATCTTTGTTTCTGAGCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail