Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9748.t1
Gene name
Locationscaffold_74:3164..4114
Strand-
Gene length (bp)950
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00810 ER_lumen_recept ER lumen protein retaining receptor 3.7E-55 28 170

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0046923 ER retention sequence binding Yes
GO:0006621 protein retention in ER lumen Yes
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0051235 maintenance of location No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0005048 signal sequence binding No
GO:0045185 maintenance of protein location No
GO:0035437 maintenance of protein localization in endoplasmic reticulum No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0051651 maintenance of location in cell No
GO:0033218 amide binding No
GO:0042277 peptide binding No
GO:0032507 maintenance of protein location in cell No
GO:0003674 molecular_function No
GO:0072595 maintenance of protein localization in organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 93 110 17
3 120 139 19
4 152 171 19
5 181 203 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9748.t1
MNIFRLLADFSHLASIFMLLQKMKTSSSCSGLSFKSQVLYLLVFVTRYLDLFWTFTDSLYLTTFKLLFIGSSAYV
IYLMLNDYKPTHDPNIDTFKVQYLLGISAVLAILFPRDYRISEILWTFSIWLESVAILPQLFMLQRTGEADTITT
HYLFALGLYRALYIPNWIFRYFTEASFQRSFQPVSIIAGIIQTLLYSDFFYIYYNKVLKGKKFSLPV*
Coding >Pro_DTO377G3_2|g9748.t1
ATGAATATCTTCAGGTTATTAGCCGACTTCTCCCATTTGGCGTCGATCTTCATGCTTCTGCAGAAGATGAAGACG
TCAAGCAGTTGTTCCGGGTTGTCGTTCAAATCGCAGGTGCTATACCTACTCGTTTTTGTCACTCGGTATCTTGAT
CTTTTCTGGACGTTCACCGACTCCCTGTACCTCACTACGTTCAAGCTTCTGTTTATCGGTTCCTCGGCCTACGTC
ATCTACCTCATGCTCAACGACTACAAACCCACACATGATCCCAATATCGATACTTTCAAAGTTCAATACCTCCTC
GGAATTAGCGCGGTGCTCGCGATTCTGTTTCCGCGCGATTATCGCATCTCCGAGATACTCTGGACTTTTTCCATT
TGGTTGGAGTCGGTTGCTATATTGCCACAATTATTCATGCTGCAACGAACCGGGGAAGCGGATACCATCACCACC
CACTATCTGTTTGCTCTGGGACTATATAGGGCACTCTACATCCCCAACTGGATTTTCCGCTATTTTACCGAAGCC
TCCTTCCAACGTTCCTTCCAGCCTGTGAGCATTATCGCCGGAATCATCCAAACTTTGCTTTACTCCGATTTCTTT
TACATTTACTACAACAAGGTTTTGAAGGGCAAGAAGTTCTCGCTTCCTGTTTAA
Transcript >Pro_DTO377G3_2|g9748.t1
ATGAATATCTTCAGGTTATTAGCCGACTTCTCCCATTTGGCGTCGATCTTCATGCTTCTGCAGAAGATGAAGACG
TCAAGCAGTTGTTCCGGGTTGTCGTTCAAATCGCAGGTGCTATACCTACTCGTTTTTGTCACTCGGTATCTTGAT
CTTTTCTGGACGTTCACCGACTCCCTGTACCTCACTACGTTCAAGCTTCTGTTTATCGGTTCCTCGGCCTACGTC
ATCTACCTCATGCTCAACGACTACAAACCCACACATGATCCCAATATCGATACTTTCAAAGTTCAATACCTCCTC
GGAATTAGCGCGGTGCTCGCGATTCTGTTTCCGCGCGATTATCGCATCTCCGAGATACTCTGGACTTTTTCCATT
TGGTTGGAGTCGGTTGCTATATTGCCACAATTATTCATGCTGCAACGAACCGGGGAAGCGGATACCATCACCACC
CACTATCTGTTTGCTCTGGGACTATATAGGGCACTCTACATCCCCAACTGGATTTTCCGCTATTTTACCGAAGCC
TCCTTCCAACGTTCCTTCCAGCCTGTGAGCATTATCGCCGGAATCATCCAAACTTTGCTTTACTCCGATTTCTTT
TACATTTACTACAACAAGGTTTTGAAGGGCAAGAAGTTCTCGCTTCCTGTTTAA
Gene >Pro_DTO377G3_2|g9748.t1
ATGAATATCTTCAGGTTATTAGGTATGGCATGAAAACTAATGGAAAACCAACGCGATATACTAACGATTGAAGCC
GACTTCTCCCATTTGGCGTCGATCTTCATGCTTCTGCAGAAGATGAAGACGTCAAGCGTATGTTTTGCTATCTAT
AAGGCCACATATGACTTGCAACTAATGGCGCGTCGCAGAGTTGTTCCGGGTTGTCGTTCAAATCGCAGGTGCTAT
ACCTACTCGTTTTTGTCACTCGGTATCTTGGTAGGTTTCGACGTCACCGTCAGCTTTATGTTGATCATAATCACT
CATGCGCCTTATAGATCTTTTCTGGACGTTCACCGACTCCCTGTACCTCACTACGTTCAAGCTTCTGTTTATCGG
TTCCTCGGCCTACGTCATCTACCTCATGCTCAACGACTACAAACCCACACATGATCCCAATATCGATACTTTCAA
AGTTCAATACCTCCTCGGAATTAGCGCGGTGCTCGCGATTCTGTTTCCGCGCGATTATCGCATCTCCGAGGTTGG
TTCCATGCTGTCTACGGTGTAGAAAGAACGGGACTAACGTCATGTAGATACTCTGGACTTTTTCCATTTGGTTGG
AGTCGGTTGCTATATTGCCACAATTATTCATGCTGCAACGAACCGGGGAAGCGGATACCATCACCACCCACTATC
TGTTTGCTCTGGGACTATATAGGGCACTCTACATCCCCAACTGGATTTTCCGCTATTTTACCGAAGCCTCCTTCC
AACGTTCCTTCCAGCCTGTGAGCATTATCGCCGGAATCATCCAAACTTTGCTTTACTCCGATTTCTTTTACATTT
ACTACAACAAGTAAGCTCAATTCGCTCAAAGAAACAAAAAAAACAGACGTATGATGCGGACACTGACCTATGCGC
TTTTTTCTCCCAGGGTTTTGAAGGGCAAGAAGTTCTCGCTTCCTGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail